Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate Pf6N2E2_3252 Histidinol dehydrogenase (EC 1.1.1.23)
Query= BRENDA::Q8G2R2 (430 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 Length = 445 Score = 394 bits (1011), Expect = e-114 Identities = 207/428 (48%), Positives = 281/428 (65%), Gaps = 1/428 (0%) Query: 2 VTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDL 61 + L DPDF LS + + V++ V +I+ VR GD+AL++++++FD + + Sbjct: 7 IRRLNAVDPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQKFDGLQV 66 Query: 62 EKTGIAVTEAE-IDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSR 120 + E ++ A EAL+ A R+ +H RQ YT+A G LG + Sbjct: 67 ASMADLILPRERLELALTRITVPQREALEKAASRVRDYHERQKQDSWSYTEADGTVLGQK 126 Query: 121 WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAG 180 T ++ GLYVPGG ASYPSSVLMNA+PAKVAGV +VMVVP P G +N LVL AA +AG Sbjct: 127 VTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLAAACIAG 186 Query: 181 VSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVL 240 V ++ +GGAQA+AALAYGTE++ V K+VGPGN YVA AKR VFG VGIDMIAGPSE+L Sbjct: 187 VDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATAKRHVFGQVGIDMIAGPSEIL 246 Query: 241 IVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASA 300 +V D +PDWIA DL +QAEHD AQ+IL++ D F V ++++ L T+ R E + Sbjct: 247 VVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDRAEIINT 306 Query: 301 SWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIG 360 S GA+I V+D E AI +ANRIA EHLE++VAD +A++P+IR+AG+IF+G +T E +G Sbjct: 307 SINGRGALIHVRDMEQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRHTSEALG 366 Query: 361 DYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAH 420 DY G NHVLPT+ +ARFSS L V D+ KR+S++ + LG A +AR E L AH Sbjct: 367 DYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARGESLSAH 426 Query: 421 AQSVAIRL 428 A+S R+ Sbjct: 427 ARSAEYRI 434 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 29 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 445 Length adjustment: 32 Effective length of query: 398 Effective length of database: 413 Effective search space: 164374 Effective search space used: 164374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate Pf6N2E2_3252 (Histidinol dehydrogenase (EC 1.1.1.23))
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.18489.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-166 538.2 0.1 7.9e-166 538.0 0.1 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 Histidinol dehydrogenase (EC 1.1 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 Histidinol dehydrogenase (EC 1.1.1.23) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 538.0 0.1 7.9e-166 7.9e-166 1 393 [] 39 433 .. 39 433 .. 0.99 Alignments for each domain: == domain 1 score: 538.0 bits; conditional E-value: 7.9e-166 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaenie 61 v +ii++vr++Gd+Al+e+t+kfd++ ++++l +++e+le al++++ +eale+aa++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 39 VLDIIKAVRERGDAALVEFTQKFDGLqvaSMADLILPRERLELALTRITVPQREALEKAASRVR 102 679*********************99556677889***************************** PP TIGR00069 62 kfhekqlpesveveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvv 125 ++he+q+++s+++++++g++lgqkv+pl+r+glYvPgGka+ypS+vlm+a+pAkvAgv+e+v+v lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 103 DYHERQKQDSWSYTEADGTVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMV 166 **************************************************************** PP TIGR00069 126 tPpkkdgkvnpavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKkl 189 P+ +g++n+ vlaaa ++gvd+v+++GGaqa+aalayGte+vp+vdk+vGPGniyV++AK++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 167 VPTP-RGEINELVLAAACIAGVDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATAKRH 229 ***6.9********************************************************** PP TIGR00069 190 vfgevgidmiaGPsEvlviadesanpelvaaDllsqaEHdedaqailvttseelaekveeevee 253 vfg+vgidmiaGPsE+lv++d +++p+++a+Dl+sqaEHdedaqailv++++e+++kv +++++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 230 VFGQVGIDMIAGPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDK 293 **************************************************************** PP TIGR00069 254 qleelerkeiaekslekngaiilvddleealelsneyApEHLelqtkdpeellkkiknaGsvfl 317 l +++r+ei+++s++ +ga+i v+d+e+a+e++n++ApEHLel ++dp+++l++i++aG++f+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 294 LLPTMDRAEIINTSINGRGALIHVRDMEQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFM 357 **************************************************************** PP TIGR00069 318 GeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeaveklaeaE 381 G++t+ealgdy+aGpnhvLPTsgtArf+s+l+v+dF+kr+s++ +s+++++el+++++ la+ E lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 358 GRHTSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARGE 421 **************************************************************** PP TIGR00069 382 gLeaHaeavevR 393 L+aHa+++e R lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3252 422 SLSAHARSAEYR 433 ********9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (445 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.10 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory