GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Pseudomonas fluorescens FW300-N2E2

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate Pf6N2E2_1668 Xylonate dehydratase (EC 4.2.1.82)

Query= curated2:A0Q0E8
         (554 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1668 Xylonate dehydratase
           (EC 4.2.1.82)
          Length = 594

 Score =  304 bits (779), Expect = 6e-87
 Identities = 195/551 (35%), Positives = 297/551 (53%), Gaps = 29/551 (5%)

Query: 23  GYTPEDLK--KPLIGIVNSHNEIIPGHFHLNEIVQAVKLGVASAGGTPIEIPSIGICDGI 80
           G T E+L+  +P+IGI  + +++ P + H  E+ Q VK G+  AGG P+E P   I +  
Sbjct: 35  GMTREELQSGRPIIGIAQTGSDLTPCNRHHLELAQRVKAGIRDAGGIPMEFPVHPIAEQS 94

Query: 81  SMNHSGMKYPLASRELIADSIEAMTIAHKFDALVLVGNCDKIVPGMLMGAARLNVPAIYV 140
               + +   LA   L+      +   +  D +VL   CDK  P  LM AA  ++PAI +
Sbjct: 95  RRPTAALDRNLAYLGLVE-----ILHGYPLDGVVLTTGCDKTTPACLMAAATTDLPAIVL 149

Query: 141 SGGPMLPGKLKGKKIDLVHGAFEAVGSYAEGILSDDDLNKIEQHSCPTCGSCAGLFTANS 200
           SGGPML G  KG+ I      + A    A G +  +   ++   + P+ G C  + TA S
Sbjct: 150 SGGPMLDGHHKGELIGSGTVLWHARNLMAAGEIDYEGFMEMTTAASPSVGHCNTMGTALS 209

Query: 201 MNSLAEALGVALPGNGTIPAPYGRRKQLAKYAGVKIMELVKKKIKLRDILTKEAFKNAIA 260
           MN+LAEALG++LPG  +IPAPY  R Q+A   G +I +LV++ I+   I+T++AF+NAIA
Sbjct: 210 MNALAEALGMSLPGCASIPAPYRERGQMAYATGKRICDLVRQDIRPSQIMTRQAFENAIA 269

Query: 261 LDMAIGGSSNTTLHLMAIAHEAKVYLTLEDFDEISRRIPHITKLSPAGTHHMVDLDEAGG 320
           +  A+G SSN   HL+AIA    V L+LED+  I   +P +    PAG +       AGG
Sbjct: 270 VASALGASSNCPPHLIAIARHMGVELSLEDWQRIGEDVPLLVNCMPAGKYLGEGFHRAGG 329

Query: 321 ISAVLKELMDANLIFKDQLTVTGKTLEENIKNSLVLNDSVIRPLNNPYSNEGGIAILRGN 380
           + +V+ EL  A  + +D  TV+GKT+ E + NSL  N  VI P + P  +  G  +L GN
Sbjct: 330 VPSVMHELQKAGRLHEDCATVSGKTIGEIVSNSLTSNTDVIHPFDTPLKHRAGFIVLSGN 389

Query: 381 LAPDGAVVKQSAV----EPEMLYHKGVARVFDGEELAFDAIMNKKIHPGD---------V 427
              D A++K S V        L   G    F+   + F+   +      D         +
Sbjct: 390 FF-DSAIMKMSVVGEAFRKTYLSEPGAENSFEARAIVFEGPEDYHARIDDPALDIDERCI 448

Query: 428 VVIRYEGPKGCPGMREM--LSPTAAIIGLGLEKSTALITDGRFSGGTRGPCIGHISPEAS 485
           +VIR  G  G PG  E+  ++P AA+I  G++ S   + DGR SG +  P I ++SPEA+
Sbjct: 449 LVIRGVGTVGYPGSAEVVNMAPPAALIKQGID-SLPCLGDGRQSGTSASPSILNMSPEAA 507

Query: 486 EGGPIALIEEGDLIEIDISNRRISLLVSPEELSKRKENWIQ--PPCKAPDGTYLKRYSKL 543
            GG +AL++  D +++D++ R ++LL+   E+++R+  WI   PP + P   + + Y +L
Sbjct: 508 VGGGLALLKTNDRLKVDLNTRTVNLLIDDAEMAQRRREWIPNIPPSQTP---WQELYRQL 564

Query: 544 VTSASTGAVLE 554
           V   STG  LE
Sbjct: 565 VGQLSTGGCLE 575


Lambda     K      H
   0.317    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 799
Number of extensions: 35
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 554
Length of database: 594
Length adjustment: 36
Effective length of query: 518
Effective length of database: 558
Effective search space:   289044
Effective search space used:   289044
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory