GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Pseudomonas fluorescens FW300-N2E2

Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate Pf6N2E2_609 L-arabonate dehydratase (EC 4.2.1.25)

Query= curated2:B9MPM8
         (552 letters)



>lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_609 L-arabonate
           dehydratase (EC 4.2.1.25)
          Length = 578

 Score =  371 bits (953), Expect = e-107
 Identities = 219/543 (40%), Positives = 321/543 (59%), Gaps = 18/543 (3%)

Query: 16  RSLFKAMGYTDEEIR-RPLIAVVNSWNEVVPGHIHLDRIAEAVKAGIRLAGATPMEFNVI 74
           RS  K  G  D +   +P+I + N+W+E+ P + H  +IAE VK G+  AG  P+EF V 
Sbjct: 25  RSWMKNQGIADHQFHGKPIIGICNTWSELTPCNAHFRQIAEHVKRGVIEAGGFPVEFPVF 84

Query: 75  GVCDGIAMGHIGMK-YSLITRELIADSIEAMVMAHQFDGMVLIPNCDKIVPGMLIAAARV 133
                 + G   ++  +++TR L +  +E  +  +  DG+VL+  CDK  P +L+ AA  
Sbjct: 85  ------SNGESNLRPTAMLTRNLASMDVEEAIRGNPIDGVVLLTGCDKTTPALLMGAASC 138

Query: 134 NIPAILISGGPMLAGKI-GDKVCDLNSVFEGVGAYSAGKISEEDLYALEENACPGCGSCS 192
           ++PAI+++GGPML GK  G  +     V++      AG I+ +D  A E       G+C+
Sbjct: 139 DVPAIVVTGGPMLNGKHKGQDIGSGTVVWQLSEQVKAGTITIDDFLAAEGGMSRSAGTCN 198

Query: 193 GMFTANTMNCLSEVLGLALPGNGTIPAVMAARIRLAKMAGMKIVELVEKDIKPSDILTVE 252
            M TA+TM C++E LG +LP N  IPAV A R  LA M+GM+ VE+V +D+K S ILT E
Sbjct: 199 TMGTASTMACMAEALGTSLPHNAAIPAVDARRYVLAHMSGMRAVEMVREDLKLSKILTKE 258

Query: 253 AFENALAVDMALGGSTNTILHLPAIANEVGIKLNLDIINAISDRTPNLCKLSPAGQHHIE 312
           AFENA+ V+ A+GGSTN ++HL AIA  +G++L+LD    I    P +  L P+G+  +E
Sbjct: 259 AFENAIRVNAAIGGSTNAVIHLKAIAGRIGVQLDLDDWTRIGRGMPTIVDLQPSGRFLME 318

Query: 313 DLYFAGGVQAVMNELSKKGLL-HLNLMTVTGKTVGENIKDANVKNYN-VIRPIDNPYSET 370
           + Y+AGG+ AV+  L +  L+ H N +TV+GK++GEN KDA +   + VIR +DNP    
Sbjct: 319 EFYYAGGLPAVLRRLGEANLIPHPNALTVSGKSIGENTKDAPIYGQDEVIRTLDNPIRAD 378

Query: 371 GGLVIVRGNLAPDGAVVKKSAVPPKLMKHRGPARVFESGEEVFEAILKGK--IQKGDVIV 428
           GG+ ++RGNLAP GAV+K SA   +LM+HRG A VFE+ +E    I   +  +    ++V
Sbjct: 379 GGICVLRGNLAPLGAVLKPSAATAELMQHRGRAVVFENFDEYKARINDPELDVDASSILV 438

Query: 429 IRYEGPKGGPGMRE---MLSPTSALAGVGLIEDVALITDGRFSGATRGACFGHVSPEAAE 485
           ++  GPKG PGM E   M  P   LA    + D+  I+D R SG   G    HV+PEAA 
Sbjct: 439 MKNCGPKGYPGMAEVGNMGLPAKLLAQG--VTDMVRISDARMSGTAYGTVVLHVAPEAAA 496

Query: 486 RGPIAAVQDGDMISIDIENKTLTLEVPEEEIKRRLEILPPFEPKVKKGYLYRYSKLVRSA 545
            GP+AAV++GD I +D  +  L L++P+ E+  RL  + P +  +  GY   Y   V  A
Sbjct: 497 GGPLAAVKEGDWIELDCTSGRLHLDIPDAELAARLADIVPPQQLLVGGYRQLYIDHVLQA 556

Query: 546 STG 548
             G
Sbjct: 557 DQG 559


Lambda     K      H
   0.318    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 775
Number of extensions: 42
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 578
Length adjustment: 36
Effective length of query: 516
Effective length of database: 542
Effective search space:   279672
Effective search space used:   279672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory