Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate Pf6N2E2_670 1-pyrroline-4-hydroxy-2-carboxylate deaminase (EC 3.5.4.22)
Query= BRENDA::Q07607 (292 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_670 Length = 305 Score = 110 bits (274), Expect = 5e-29 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 6/241 (2%) Query: 2 FEGSITALVTPFADD-RIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVE 60 + G A+ T F DD I+ H ++ I +G GLV CG+ GE+ +LS E V E Sbjct: 7 WSGVFPAVTTQFNDDFSINLEKTHQVISNVIRDGVSGLVVCGSVGENTSLSAEEKIAVTE 66 Query: 61 ITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSP--YYNKPTQEGIYQHF 118 + + + GRVPVI G ++ +A + G DGV+++ Y +KP + +HF Sbjct: 67 VAVDASRGRVPVICGVAEFTSVQAAKVANAVRKVGVDGVMLMPALVYGSKPFETA--EHF 124 Query: 119 KAIDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVKDATGNLLRPSLERMACG 178 + + + +P++VYN P ++ + L + DC NV KD++G+ R R G Sbjct: 125 RYVARHADVPLMVYNNPPIYKNDVTPDILISL-ADCDNVVCFKDSSGDTRRFIDVRNEVG 183 Query: 179 EDFNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMP 238 + F L G D L +A G G +S +NV P + G FA A+ + + LMP Sbjct: 184 DRFVLFAGLDDVVLESLAVGAEGWVSGMSNVFPQEGETIFRLARAGRFAEAMPIYEWLMP 243 Query: 239 L 239 + Sbjct: 244 I 244 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 305 Length adjustment: 27 Effective length of query: 265 Effective length of database: 278 Effective search space: 73670 Effective search space used: 73670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory