Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate Pf6N2E2_6030 Diaminopimelate epimerase (EC 5.1.1.7)
Query= curated2:Q3IZB6 (279 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 Length = 267 Score = 246 bits (628), Expect = 4e-70 Identities = 129/264 (48%), Positives = 167/264 (63%), Gaps = 2/264 (0%) Query: 10 LGFMKMHGAGNDFVVIDSRGRGGALVTAGLARALGDRHRGVGFDQLAEIRDQEGADCALD 69 L F KMH G+DFV++DSR VT+ +A+ +GDR+RGVGF+QLA + D + AD + Sbjct: 3 LNFQKMHANGDDFVIVDSRHSANP-VTSAMAQRMGDRNRGVGFNQLAVLLDCDDADARVM 61 Query: 70 FWNSDGSRSGTCGNATRCVSDYLMRDLGRDEVNLVTARGRLHARRREDGLVAVNMGAPQL 129 FWN+DGS CG+ATR +D LMR+ V L T RG L R G ++V+MG P Sbjct: 62 FWNADGSALDVCGSATRGAADMLMREANVASVALRTNRGLLTCERTPTGDISVDMGVPLF 121 Query: 130 LWSEIPLARAMETDSLPLEGTPSAVGMGNPHCIYFVEDAEAVDLAGRGAAVETDPLFPER 189 WS+IPLA+ ++T LPL G+P A MGNPHC YFV+D VD+A G A+ET+ LFP + Sbjct: 122 DWSDIPLAQELDTTVLPLAGSPVACSMGNPHCTYFVDDLATVDIATIGPAIETNALFPLK 181 Query: 190 TNVEFASLIGPDRLRLRVWERGAGITLACGSGACATAVAAARRGLTGRQVRLEMDGGVLE 249 TNV F +I +RLR+WERGAGI L GS +C V RRGL +V +E DGG + Sbjct: 182 TNVHFVQIIDRTHIRLRIWERGAGIALGSGSCSCGAVVNGIRRGLLDPRVEVECDGGSVT 241 Query: 250 VDWRDEG-VWLSGPVARVFEGHLS 272 V W G V+L GPV F G +S Sbjct: 242 VQWDGVGAVFLIGPVEVSFSGTMS 265 Lambda K H 0.321 0.138 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 267 Length adjustment: 25 Effective length of query: 254 Effective length of database: 242 Effective search space: 61468 Effective search space used: 61468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Pf6N2E2_6030 (Diaminopimelate epimerase (EC 5.1.1.7))
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.28259.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-62 195.6 0.0 6.3e-62 195.4 0.0 1.0 1 lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 Diaminopimelate epimerase (EC 5. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 Diaminopimelate epimerase (EC 5.1.1.7) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 195.4 0.0 6.3e-62 6.3e-62 2 268 .. 4 264 .. 3 266 .. 0.95 Alignments for each domain: == domain 1 score: 195.4 bits; conditional E-value: 6.3e-62 TIGR00652 2 eFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNs 65 +F kmh++g dFv+vd++++ + + +++++++ dr+ gvg+ ++ ++ + ++ad+++ ++N+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 4 NFQKMHANGDDFVIVDSRHSANPVT-SAMAQRMGDRNRGVGFNQLAVLL-DCDDADARVMFWNA 65 7******************999998.79*****************9999.59************ PP TIGR00652 66 DGSeaemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeei 129 DGS+ + CG + R +a ++ ++ + ++ + t++gl+++e + ++ +++vdmg p f ++i lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 66 DGSALDVCGSATRGAADMLMREANV--ASVALRTNRGLLTCERTPTG-DISVDMGVPLFDWSDI 126 ********************99999..79******************.**************** PP TIGR00652 130 pltvekeeekeellalev..lvvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefv 191 pl +e +++ +l l+ ++ ++GnPH+ fv+d+ ++d+ ++g+++e++ fp ++Nv+fv lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 127 PLAQELDTT---VLPLAGspVACSMGNPHCTYFVDDLATVDIATIGPAIETNALFPLKTNVHFV 187 **9965555...555444348******************************************* PP TIGR00652 192 evkkedeiklrvyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedgkvy 255 ++ ++ +i+lr++ERGag+ l G+ ++ ++v +++ g+++ +v+v+ +gg++++++ g v+ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 188 QIIDRTHIRLRIWERGAGIALGSGSCSCGAVVNGIRRGLLDPRVEVECDGGSVTVQWDGVGAVF 251 **************************************************************** PP TIGR00652 256 ltGpavlvlegel 268 l Gp+++ ++g++ lcl|FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6030 252 LIGPVEVSFSGTM 264 *******999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.68 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory