Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate Pf6N2E2_1300 Cyclohexadienyl dehydratase (EC 4.2.1.51)(EC 4.2.1.91)
Query= BRENDA::Q01269 (268 letters) >FitnessBrowser__pseudo6_N2E2:Pf6N2E2_1300 Length = 263 Score = 238 bits (608), Expect = 7e-68 Identities = 122/245 (49%), Positives = 165/245 (67%), Gaps = 2/245 (0%) Query: 15 LALLASASLQAQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESL 74 LAL A + S LD++L+ G L+V TTGDYKP++++T G Y G D+DMA+ LA SL Sbjct: 14 LALSCGALAEPTPSLLDQVLQRGELKVCTTGDYKPYTFKTATGEYEGIDIDMARSLAASL 73 Query: 75 GAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEE 134 G K+ V T+W LM D + DI M GIS+ LERQ++AYFS DGK P+ C ++ Sbjct: 74 GVKVQWVQTTWKTLMPDMVAGQCDIGMGGISVTLERQKKAYFSDTLDVDGKIPLVRCEDK 133 Query: 135 ARFQTLEQIDQPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMT 194 R+QTLEQ++QP V + GGTNE F RA L ++ H DNVTIFQQ++D KAD+M+T Sbjct: 134 ERYQTLEQMNQPSVRLVEPAGGTNEAFVRAFLPNGQLNFH-DNVTIFQQLLDKKADVMIT 192 Query: 195 DAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDE-AFKRYVDQWLHIAEQSGLLRQR 253 DA EA Q +L P LCAV+P + + EKAYLLPRD+ +K YVDQWLH+++ +G ++ Sbjct: 193 DASEALYQQKLKPGLCAVNPTRYLQYGEKAYLLPRDDNTWKMYVDQWLHLSKANGSYQKV 252 Query: 254 MEHWL 258 + WL Sbjct: 253 IGQWL 257 Lambda K H 0.322 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 263 Length adjustment: 25 Effective length of query: 243 Effective length of database: 238 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory