Align Carbamoyl-phosphate synthase pyrimidine-specific small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate 208631 DVU3113 carbamoyl-phosphate synthase, small subunit
Query= SwissProt::P25993 (364 letters) >MicrobesOnline__882:208631 Length = 375 Score = 328 bits (842), Expect = 1e-94 Identities = 164/371 (44%), Positives = 229/371 (61%), Gaps = 23/371 (6%) Query: 1 MKRRLVLENGAVFEGEAFGSLEHNMGEVVFNTGMTGYQEILSDPSYCGQIVTLTYPLIGN 60 M+ L LE+G V EG +F GE +FNTGMTGYQE+L+DPSY GQ+V +TYPL+GN Sbjct: 1 MRALLALEDGFVLEGRSFTGPGETGGEAIFNTGMTGYQEVLTDPSYAGQMVCMTYPLVGN 60 Query: 61 YGINRDDFESITPFVKGLIIKELCELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMI 120 YG+ R+D ES V+ I+KE C++PSNWRS +L +YLK + G++GIDTR LTR + Sbjct: 61 YGVTREDMESGKVHVEAFIVKECCKVPSNWRSEISLPDYLKRHGVMGIEGIDTRALTRHL 120 Query: 121 RTAGALKGTFASSDEDIEAVLKRLNETELPRNQVSQVSAKTAYPSP-------------- 166 R GA++G ++ + D +++R LP + + + A +P Sbjct: 121 RIHGAMRGVISTQETDPARLVERARA--LPSMEGQNLVTRVAPAAPYRWDGERPQAVTLE 178 Query: 167 -------GRGKRIVLVDFGMKHGILRELNKRKCDVIVVPYNITAEEVLQLKPDGIMLSNG 219 G+G R+V+ DFG+K ILR L ++ D++VVP + A +V + + LSNG Sbjct: 179 PGGCAWVGKGPRLVVYDFGIKWNILRLLAQQGFDMLVVPPSFKAADVAAVGAQAVFLSNG 238 Query: 220 PGDPKDVPEAIEMIKGVLGKVPLFGICLGHQLFALACGANTEKMKFGHRGSNHPVKELAT 279 PGDP + + I I + P GICLGHQL A G T K+KFGH G NHPVK+L T Sbjct: 239 PGDPATLKDEIAEIAKLAQTYPTAGICLGHQLLGHALGGRTMKLKFGHHGCNHPVKDLTT 298 Query: 280 GKVALTSQNHGYTVSSISKTELEVTHIAINDDTIEGLKHKTLPAFTVQYHPEASPGPEDA 339 G++ ++SQNHG+ V S T++E+TH+ +ND T+EG HKT P VQ+HPEASPGP D+ Sbjct: 299 GRIEISSQNHGFCVDIDSLTDVEITHVNLNDGTLEGFAHKTKPVIAVQHHPEASPGPNDS 358 Query: 340 NHLFDRFIEMI 350 + F RF M+ Sbjct: 359 RYFFARFRNMV 369 Lambda K H 0.317 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 375 Length adjustment: 30 Effective length of query: 334 Effective length of database: 345 Effective search space: 115230 Effective search space used: 115230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 208631 DVU3113 (carbamoyl-phosphate synthase, small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.27196.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-144 467.1 0.0 2.1e-144 466.9 0.0 1.0 1 lcl|MicrobesOnline__882:208631 DVU3113 carbamoyl-phosphate synt Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:208631 DVU3113 carbamoyl-phosphate synthase, small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 466.9 0.0 2.1e-144 2.1e-144 1 360 [. 3 370 .. 3 371 .. 0.96 Alignments for each domain: == domain 1 score: 466.9 bits; conditional E-value: 2.1e-144 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkglvvk 79 a l+ledG v+eg+sf ++e+ Ge +FnT+mtGYqE+ltDpsY+gq+v +typl+gnygv++ed+es k++v++++vk lcl|MicrobesOnline__882:208631 3 ALLALEDGFVLEGRSFTGPGETGGEAIFNTGMTGYQEVLTDPSYAGQMVCMTYPLVGNYGVTREDMESGKVHVEAFIVK 81 579**************************************************************************** PP TIGR01368 80 elskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakespkvkevnlvkevs 158 e++k +sn+r++ sL ++lk++g+++ieg+DTRal+++lR +g+m++vist++++ +lve+a++ p+++++nlv++v+ lcl|MicrobesOnline__882:208631 82 ECCKVPSNWRSEISLPDYLKRHGVMGIEGIDTRALTRHLRIHGAMRGVISTQETDPARLVERARALPSMEGQNLVTRVA 160 ******************************************************************************* PP TIGR01368 159 tkeayeleq...k........akkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgillsnGP 226 + +y++ + gk r+vv+d+G+K nilr L+++g+++ vvp +++a++++++ ++++lsnGP lcl|MicrobesOnline__882:208631 161 PAAPYRWDGerpQavtlepggCAWVGKGPRLVVYDFGIKWNILRLLAQQGFDMLVVPPSFKAADVAAVGAQAVFLSNGP 239 *******99666155555666455555668************************************************* PP TIGR01368 227 GdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeesl 305 GdPa++++ i+++ kl++ ++P+ GIclGhqll+ alg++t+klkfGh+G Nhpvkdl+tgr+ei+sqNHg+ vd +sl lcl|MicrobesOnline__882:208631 240 GDPATLKDEIAEIAKLAQ-TYPTAGICLGHQLLGHALGGRTMKLKFGHHGCNHPVKDLTTGRIEISSQNHGFCVDIDSL 317 ******************.***********************************************************6 PP TIGR01368 306 keeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 + ++e+thvnlnDgt+eg +hk++pv++vQ+HPeaspGp+d++y+F +f ++++ lcl|MicrobesOnline__882:208631 318 T--DVEITHVNLNDGTLEGFAHKTKPVIAVQHHPEASPGPNDSRYFFARFRNMVR 370 6..89*********************************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.88 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory