Align glutamyl-tRNAGln amidotransferase subunit B (EC 6.3.5.7) (characterized)
to candidate 207351 DVU1885 glutamyl-tRNA(Gln) amidotransferase, B subunit
Query= metacyc::MONOMER-13956 (476 letters) >MicrobesOnline__882:207351 Length = 476 Score = 460 bits (1183), Expect = e-134 Identities = 228/473 (48%), Positives = 321/473 (67%), Gaps = 1/473 (0%) Query: 2 NFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAMK 61 ++E VIGLEVH +L+T+SK+F S T FGA+ N + G PGVLPVLN++AVEFA + Sbjct: 3 SYEAVIGLEVHAQLRTRSKLFCSCSTAFGADPNAHVCEVCAGMPGVLPVLNEKAVEFAAR 62 Query: 62 AAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVGGKTKRIGITRL 121 +A+ C + + F RKNYFYPD PK YQISQ+++PI E+G ++I VG KRIGITR+ Sbjct: 63 MGIAVGCTVNRTSVFARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDAVKRIGITRI 122 Query: 122 HLEEDAGKLTHT-GDGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQYTGV 180 HLE+DAGK H+ G+ S VD NR G PL+EIVSEPD+R+ EEA AYL+ L++I+ + G+ Sbjct: 123 HLEDDAGKNIHSAGENVSYVDLNRTGVPLIEIVSEPDLRSAEEAVAYLKALRAIVVHLGI 182 Query: 181 SDCKMEEGSLRCDANISLRPIGQEEFGTKTELKNLNSFAFVQKGLEHEEKRQEQVLLSGF 240 D MEEGS RCDAN+SLRP G EFGT+ ELKNLNSF VQ+ +E+E RQ +L G Sbjct: 183 CDGNMEEGSFRCDANVSLRPRGAAEFGTRAELKNLNSFRHVQRAIEYEISRQADLLDDGD 242 Query: 241 FIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVKASIPELPDER 300 + QETR YD T+ MR KE + DYRYFP+PDL+ ++ID+ +A++PELP R Sbjct: 243 KVVQETRLYDSVKNITVSMRGKEEAHDYRYFPDPDLIPIHIDEARLAEWQATLPELPQAR 302 Query: 301 RKRYIEELGFAAYDAMVLTLTKEMADFFEETVQKGAEAKQASNWLMGEVSAYLNAEQKEL 360 +R++ G +A DA VLT ++ A+FFE V+ + ++ +N ++G + LN L Sbjct: 303 LERFMSSFGLSAQDAEVLTAERDHAEFFEAAVKLYDQPRKIANMMLGPLQRELNQRGTSL 362 Query: 361 ADVALTPEGLAGMIKLIEKGTISSKIAKKVFKELIEKGGDAEKIVKEKGLVQISDEGVLL 420 A A+ PE LA ++++I+ G IS+KI VF EL E G E V+E+GLVQISD + Sbjct: 363 AVSAMRPEALAELVRIIDAGLISAKIGNDVFGELFENGAMPEAFVRERGLVQISDTSAIE 422 Query: 421 KLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKILLEEI 473 + V E + NP +E ++ GK + + F VGQ+M+ ++G+ANP +VN++L ++ Sbjct: 423 QAVDEVIAENPAEVEAYRGGKTKLVSFFVGQVMRKTRGKANPALVNELLASKL 475 Lambda K H 0.314 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 476 Length adjustment: 33 Effective length of query: 443 Effective length of database: 443 Effective search space: 196249 Effective search space used: 196249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
Align candidate 207351 DVU1885 (glutamyl-tRNA(Gln) amidotransferase, B subunit)
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.6899.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-185 603.3 0.0 1.6e-185 603.1 0.0 1.0 1 lcl|MicrobesOnline__882:207351 DVU1885 glutamyl-tRNA(Gln) amido Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:207351 DVU1885 glutamyl-tRNA(Gln) amidotransferase, B subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 603.1 0.0 1.6e-185 1.6e-185 1 480 [. 1 475 [. 1 476 [] 0.99 Alignments for each domain: == domain 1 score: 603.1 bits; conditional E-value: 1.6e-185 TIGR00133 1 kieyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalnskivsevsvF 79 + +ye+viGlEvH ql t+sKlFc+cs+ + pN +vc vc g+PG+lPvlN++av++A ++ a+++ ++ +svF lcl|MicrobesOnline__882:207351 1 MASYEAVIGLEVHAQLRTRSKLFCSCSTAFGA-DPNAHVCEVCAGMPGVLPVLNEKAVEFAARMGIAVGCTVN-RTSVF 77 5689**************************99.9*************************************66.5**** PP TIGR00133 80 dRKhYfYpDlPkgyqitqqdlPiaedGkleieleekekeigierlhlEeDtgksqykesdkdkqslvDfNRsgvPLlEi 158 +RK+YfYpDlPkgyqi+q+++Pi+e+G+l+i++ + k+igi+r+hlE+D+gk+ + ++ s+vD+NR+gvPL+Ei lcl|MicrobesOnline__882:207351 78 ARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDAVKRIGITRIHLEDDAGKNIHSAG--ENVSYVDLNRTGVPLIEI 154 ********************************************************966..58**************** PP TIGR00133 159 VtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvsirlkGqekegtrvEiKNlnslksiekaieyEieR 237 V++Pdl+sa+ea+a+lk lr+i+ +l+i dg++eeGs+R+D+Nvs+r++G ++gtr+E+KNlns++ +++aieyEi R lcl|MicrobesOnline__882:207351 155 VSEPDLRSAEEAVAYLKALRAIVVHLGICDGNMEEGSFRCDANVSLRPRGAAEFGTRAELKNLNSFRHVQRAIEYEISR 233 ******************************************************************************* PP TIGR00133 238 qkkllkkgeevkqetrafdekksitvslRkKeeseDYRYfpePdlppieideevvkekveeklpelPeakrirlkkeyg 316 q +ll +g++v+qetr +d k+itvs+R Kee++DYRYfp+Pdl pi+ide + e ++++lpelP+a+ +r+++ +g lcl|MicrobesOnline__882:207351 234 QADLLDDGDKVVQETRLYDSVKNITVSMRGKEEAHDYRYFPDPDLIPIHIDEARLAE-WQATLPELPQARLERFMSSFG 311 ******************************************************999.********************* PP TIGR00133 317 lseedakvlvsdlelldafeevvklikepklavnWileellgeLnkkkislaeallkpeelaeliklikegkisqksak 395 ls++da+vl+++++ ++ fe +vkl ++p++ +n +l l++eLn++ +sla ++++pe+lael+++i++g is+k++ lcl|MicrobesOnline__882:207351 312 LSAQDAEVLTAERDHAEFFEAAVKLYDQPRKIANMMLGPLQRELNQRGTSLAVSAMRPEALAELVRIIDAGLISAKIGN 390 ******************************************************************************* PP TIGR00133 396 elleellenkkdpkklieklgliqisdekelvkiveevikenpkevekyksgkekalkflvGqvmkktkgradpkevek 474 +++ el+en+ +p++ ++++gl+qisd++++ ++v+evi+enp eve y+ gk k++ f+vGqvm+kt+g+a+p+ v++ lcl|MicrobesOnline__882:207351 391 DVFGELFENGAMPEAFVRERGLVQISDTSAIEQAVDEVIAENPAEVEAYRGGKTKLVSFFVGQVMRKTRGKANPALVNE 469 ******************************************************************************* PP TIGR00133 475 llkell 480 ll +l lcl|MicrobesOnline__882:207351 470 LLASKL 475 *98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (476 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory