Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate 206235 DVU0809 glutamyl-tRNA(Gln) amidotransferase, C subunit
Query= curated2:Q313S4 (94 letters) >MicrobesOnline__882:206235 Length = 94 Score = 128 bits (322), Expect = 1e-35 Identities = 64/94 (68%), Positives = 71/94 (75%) Query: 1 MSISKEQVAAIAGLARLQLDEDKKELFAGQFAQILEYMDTLNEVDTDGVAPLYSPVQHAT 60 M ISKEQVA IA LARL LDE + E FAGQF IL+YMD L VDT V PLYSP +H T Sbjct: 1 MKISKEQVATIARLARLDLDEARLERFAGQFGDILDYMDMLGAVDTTDVEPLYSPSEHGT 60 Query: 61 VYREDEVQRHCSREQVLANAPEEDGTFFIVPRIV 94 V R DEV HC+RE++LANAPE DG FF+VPRIV Sbjct: 61 VLRADEVHTHCTREELLANAPESDGQFFVVPRIV 94 Lambda K H 0.318 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 62 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 94 Length of database: 94 Length adjustment: 10 Effective length of query: 84 Effective length of database: 84 Effective search space: 7056 Effective search space used: 7056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 39 (19.6 bits)
Align candidate 206235 DVU0809 (glutamyl-tRNA(Gln) amidotransferase, C subunit)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.19738.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.19738.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.