Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate 207835 DVU2347 acetylornithine aminotransferase
Query= SwissProt::Q94AL9 (477 letters) >MicrobesOnline__882:207835 Length = 399 Score = 195 bits (495), Expect = 3e-54 Identities = 114/347 (32%), Positives = 177/347 (51%), Gaps = 24/347 (6%) Query: 78 RKPLNIVDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYL 137 R P+++ + ++D GR Y+D +GIAV + GHCHP++ E + Q ++L H + L+ Sbjct: 22 RYPISVQRAEGSRMWDHEGREYIDLLSGIAVTSLGHCHPELAEVMARQARKLVHVSNLFY 81 Query: 138 NHAIADFSEALASKLPGDLKVVFFTNSGTEANELALMMAKLY------TGCQDIVAVRNG 191 D +E L S L FF NSG EANE A+ +A+ Y ++V + Sbjct: 82 QEEQLDLAEKLLSTL--HCTKAFFCNSGAEANEAAIKLARRYMQRVRGVDAHEVVTLTGA 139 Query: 192 YHGNAAATMGATGQSMWKFNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTG 251 +HG AT+ ATGQ ++ A P +R D D ++ T Sbjct: 140 FHGRTLATVAATGQERFQDGF-------APMPAGFRQAEWGD--------IDALRAAITP 184 Query: 252 HIAGFICEAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHN 311 AG + E +QG GG+ + Y A D ++ G L + DE+Q+G RTG FW + + Sbjct: 185 ATAGVLVEMVQGEGGVRPMTQDYARAVADLCREKGVLLMVDEIQTGLCRTGRFWAHQHYG 244 Query: 312 VVPDIVTMAKGIGNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKE 371 V PDIVT AK + NG P+GA++TT E+A S+ TFG ++ ++ A L++++++ Sbjct: 245 VEPDIVTSAKALANGLPMGAMMTTDEVAQGFVAGSHATTFGAGALVSSVAAATLDIMKRD 304 Query: 372 KLQENAAMVGSYLKEKLTQLKEK-HEIIGDVRGRGLMLGVELVSDRK 417 +L E A VG E+ + K I +VRG GLM+G+ L K Sbjct: 305 RLDERATAVGGRAMERFRAIGAKLPGTIEEVRGYGLMIGIVLTFSGK 351 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 399 Length adjustment: 32 Effective length of query: 445 Effective length of database: 367 Effective search space: 163315 Effective search space used: 163315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory