Align Imidazole glycerol phosphate synthase subunit HisH; EC 4.3.2.10; IGP synthase glutaminase subunit; EC 3.5.1.2; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH (uncharacterized)
to candidate 209219 DVU0285 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
Query= curated2:C6C1X6 (212 letters) >lcl|MicrobesOnline__882:209219 DVU0285 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Length = 213 Score = 321 bits (822), Expect = 7e-93 Identities = 148/212 (69%), Positives = 175/212 (82%) Query: 1 MLAILDYKAGNQTSVQRALNKLGIPNQITSDKEVLSKATGIIFPGVGAAGQAMDELTSGG 60 MLAILDYKAGNQTSV+RAL+ LGIP IT+D EV+ A G+IFPGVGAAGQAM+EL + G Sbjct: 1 MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTG 60 Query: 61 LDELLKDLVQQKKPLLGICVGCQILLDYSEENDTQALSVIPGECRLFNPSWEDYEGVPIR 120 LDE+L+ VQ +PLLGICVGCQI+LDYS+ENDT+AL +IPGECRLFNP+W D +G PIR Sbjct: 61 LDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIR 120 Query: 121 VPHMGWNQIELKQDCILFKDIDPEAHFYFVHSYYPAPEEKYIIGETIYGRPFCSLHGREG 180 VPHMGWN I ++ C L K I+PEA FYFVHSYYPAP E+Y+I YG FC++HG G Sbjct: 121 VPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPG 180 Query: 181 LWAVQFHPEKSGRPGLKLLSNFYEYCKEVSDA 212 LWAVQFHPEKSGRPGL+LL+NF+ YC E +DA Sbjct: 181 LWAVQFHPEKSGRPGLRLLANFHRYCTEAADA 212 Lambda K H 0.319 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 213 Length adjustment: 21 Effective length of query: 191 Effective length of database: 192 Effective search space: 36672 Effective search space used: 36672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate 209219 DVU0285 (imidazole glycerol phosphate synthase, glutamine amidotransferase subunit)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01855.hmm # target sequence database: /tmp/gapView.10943.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01855 [M=198] Accession: TIGR01855 Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-60 189.4 0.0 3.5e-60 189.2 0.0 1.0 1 lcl|MicrobesOnline__882:209219 DVU0285 imidazole glycerol phosp Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:209219 DVU0285 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 189.2 0.0 3.5e-60 3.5e-60 2 197 .. 3 204 .. 2 205 .. 0.96 Alignments for each domain: == domain 1 score: 189.2 bits; conditional E-value: 3.5e-60 TIGR01855 2 vvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvkkkkpvlgiClG 80 +++dy++gN +sv++al+++g ++++d + ++ a +++PGVGa+ +am++l ++l+ + +++v++++p+lgiC+G lcl|MicrobesOnline__882:209219 3 AILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTGLDEVLRRQVQAGRPLLGICVG 81 79********************************************************998889*************** PP TIGR01855 81 mQllfekseEgkevkglglikgkvkkleaek........kvPhiGWnevevvkesellkgleeearvYfvHsYavelee 151 Q++++ s+E +++k+lg+i+g+ + ++ + +vPh+GWn++ + +ellkg+e ea++YfvHsY+ + e lcl|MicrobesOnline__882:209219 82 CQIMLDYSQE-NDTKALGIIPGECRLFNPAWtdedgapiRVPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPE 159 **********.579*************987667789999***********************************99987 PP TIGR01855 152 eeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknfle 197 e+v+a+++yg++f a+ + +vQFHPEkSg+ Gl+ll nf + lcl|MicrobesOnline__882:209219 160 -EYVIATCTYGAEFCAIHGGPGLWAVQFHPEKSGRPGLRLLANFHR 204 .8*****************************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (198 nodes) Target sequences: 1 (213 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.03 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory