Align Homocysteine formation from aspartate semialdehyde (COG2122 or apbE like component) (characterized)
to candidate 206532 DVU1097 conserved hypothetical protein
Query= reanno::Miya:8499265 (277 letters) >MicrobesOnline__882:206532 Length = 249 Score = 337 bits (864), Expect = 2e-97 Identities = 175/256 (68%), Positives = 199/256 (77%), Gaps = 12/256 (4%) Query: 22 VHTDHVRGYRKRTARHPDEVVFQVVVEETDLWVTARSGLSGQPGQPVQPDLPDRIAAYVT 81 VHT VR YR R AR E VFQVVVEETDL VTA + +L +AAYV Sbjct: 6 VHTSPVRDYRNRCARREGETVFQVVVEETDLRVTALA------------ELATPMAAYVG 53 Query: 82 ELRGQIKAWMLLAPDFRTSLVPVPTPASAPEVARRMAHGADIAGVGPFAAVAGTVAQMVA 141 ELR Q+K WM P FR SLVPV P APEV RRMAHGA + GVGPFAAVAGT+AQMVA Sbjct: 54 ELRAQLKVWMEFQPAFRHSLVPVEVPEGAPEVVRRMAHGARLVGVGPFAAVAGTIAQMVA 113 Query: 142 ERFAPVSPDIIVENGGDIYICSQRDRVVGLLPDPASGEMIGVVVKAADCPVSLCSSSATI 201 ERF VSP++IVENGGD+Y+ S+RDRVVG+LPDPASG+M+G++V+A PVSLC SSA I Sbjct: 114 ERFVDVSPELIVENGGDLYLYSERDRVVGILPDPASGDMVGILVRAGTAPVSLCGSSARI 173 Query: 202 GHSLSLGVGNIAAVRARDASLADAAATLFGNMLQGPDDVARVTERAAAMAHLGIEGVYAQ 261 GHSLSLG G++A VRARDASLADAAAT FGNML+ DDVA VTERAA +A +GIEGVYAQ Sbjct: 174 GHSLSLGDGDLAVVRARDASLADAAATAFGNMLRRADDVAAVTERAAQLASIGIEGVYAQ 233 Query: 262 CGGRVGIWGNMELAVA 277 CGGR+GIWG+MELAVA Sbjct: 234 CGGRIGIWGDMELAVA 249 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 277 Length of database: 249 Length adjustment: 25 Effective length of query: 252 Effective length of database: 224 Effective search space: 56448 Effective search space used: 56448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory