Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate 206911 DVU1466 acetylglutamate kinase
Query= curated2:A9A1K7 (267 letters) >MicrobesOnline__882:206911 Length = 308 Score = 127 bits (319), Expect = 3e-34 Identities = 84/259 (32%), Positives = 138/259 (53%), Gaps = 16/259 (6%) Query: 2 ITIKIGGSVVDD-----LHPSTIADIKKIAESEGVILVHGGGKEVTKVCEQLGKEPKFVT 56 + IK GG + D +A +K + + ++VHGGG ++ K+ EQL + F Sbjct: 29 VVIKYGGHAMKDEALKKAFALNVALLKLVGINP--VIVHGGGPQIGKMLEQLNIQSHF-- 84 Query: 57 SPSGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKL 116 G+ R TD T ++ MV+ G++NK IV + G A+GLSG D +I A RK ++ Sbjct: 85 -REGL--RVTDDATMDVVEMVLVGKVNKEIVNQMNLAGAKAVGLSGKDGMLIRA-RKMEM 140 Query: 117 LIVNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAA 176 +I E + ID G G++ VN + ++SL G PVI+P+ + + E N++ D A Sbjct: 141 VISKEAQAPEIIDLGKVGEVMGVNTTLLRSLERDGFVPVIAPVGVDDNGETYNINADAVA 200 Query: 177 AYVAGKVGSDKVLFITNVDGLL-MDDKVVPKLTLAEAKEI--RPKIGPGMEKKILASTEA 233 VA + + ++L +T+V G+L D K++ + + EA + + GM K+ EA Sbjct: 201 GAVAAALKAKRLLLLTDVAGILDHDKKLIRSVNMREAVNLFSDGTLTGGMIPKVKCCLEA 260 Query: 234 LDMGVTTALIANGQKENPI 252 L+ GV A+I +G+ EN I Sbjct: 261 LEEGVEKAMIIDGRTENCI 279 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 308 Length adjustment: 26 Effective length of query: 241 Effective length of database: 282 Effective search space: 67962 Effective search space used: 67962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory