Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate WP_011386328.1 AMB_RS20110 histidinol-phosphate aminotransferase
Query= reanno::azobra:AZOBR_RS20485 (364 letters) >NCBI__GCF_000009985.1:WP_011386328.1 Length = 363 Score = 442 bits (1138), Expect = e-129 Identities = 228/362 (62%), Positives = 274/362 (75%), Gaps = 7/362 (1%) Query: 8 PAPRPGILDIAPYVGGEHAGH-----IRLASNEGALGPSPRAVEAYRAAAGELHRYPDGG 62 PAPRPGI+DI PYVGGE A ++L+SNEGALGPSP+A+EA RA A E+HRYPDGG Sbjct: 4 PAPRPGIMDIRPYVGGESAIEGVDRILKLSSNEGALGPSPKAMEALRAMAPEMHRYPDGG 63 Query: 63 SAKLRKAIAERFGLDADRVVCGAGSDELIALLIRAYAGPGDEVLYSQHGFLMYPIGAKSV 122 + LRKAI RFGLDA R+VCGAGSDEL+ +L RAYAGPGDEVLYS HGFLMY I AK+ Sbjct: 64 AEDLRKAIGARFGLDASRIVCGAGSDELLGILCRAYAGPGDEVLYSAHGFLMYAIAAKAC 123 Query: 123 GATPVQAPETNLTTDVDSLLAHVTPRTRLVFVANPNNPTGTYITADEMARLHAGLPENAI 182 GATPV APE +LT +VD+LLA VTPRT+++F+ANPNNPTGTY+ A E+ARL AGL + + Sbjct: 124 GATPVTAPEVDLTANVDNLLAAVTPRTKILFLANPNNPTGTYLPATEVARLRAGLRADIL 183 Query: 183 LVIDAAYAEYMNHNDYSAGQELVDRFPNVVMTRTFSKIFALGSVRLGWAYCPAGIADVLN 242 LVIDAAY E+++ NDYS G ELV+ NVV+ RTFSK++ALG +RLGWAYCP +A VLN Sbjct: 184 LVIDAAYTEFVSRNDYSGGIELVEAGDNVVVCRTFSKMYALGGLRLGWAYCPENVAGVLN 243 Query: 243 RVRGPFNVSSAAQIAGVAALEDTAFLERSRSHNIEWREWFVQQVHGLGLKTHPSVTNFVL 302 RVR PFNV + A AG+AA DTA+ E +SHN W W Q+ LGL PSV NF+L Sbjct: 244 RVRNPFNVGAPALAAGLAAFNDTAYAELCKSHNDYWLPWLSGQLAELGLTVVPSVCNFIL 303 Query: 303 VDFAGQTAGKDDAEAARLFLKGRGILVRQMPAYGLPSCLRVTIGTEAEMREVVQALKDFL 362 V F + AGK DA AA FL+ +GI+VR M YGL CLR+TIGT E + VV ALK+F+ Sbjct: 304 VRFP-KDAGK-DAGAADKFLRSKGIIVRAMGGYGLGDCLRITIGTGEENQLVVAALKEFV 361 Query: 363 AA 364 A Sbjct: 362 GA 363 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 363 Length adjustment: 29 Effective length of query: 335 Effective length of database: 334 Effective search space: 111890 Effective search space used: 111890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011386328.1 AMB_RS20110 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.8892.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-92 295.2 0.0 3.1e-92 295.1 0.0 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011386328.1 AMB_RS20110 histidinol-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011386328.1 AMB_RS20110 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 295.1 0.0 3.1e-92 3.1e-92 1 348 [. 7 359 .. 7 360 .. 0.96 Alignments for each domain: == domain 1 score: 295.1 bits; conditional E-value: 3.1e-92 TIGR01141 1 rekikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakyl 68 r+ i ++ pY+ g++++ + ++kL+snE ++gps+k++eal++ + ++hrYpd a +l++a+ +++ lcl|NCBI__GCF_000009985.1:WP_011386328.1 7 RPGIMDIRPYVGGESAIEGVdRILKLSSNEGALGPSPKAMEALRAMAPEMHRYPDGGAEDLRKAIGARF 75 678999*******8887666699********************************************** PP TIGR01141 69 gveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavl 137 g+++ i+ g+Gsdel+ +l+ra++ pgd+vl++ + + mY++ ak++ga +++p + + +++++l lcl|NCBI__GCF_000009985.1:WP_011386328.1 76 GLDASRIVCGAGSDELLGILCRAYAGPGDEVLYSAHGFLMYAIAAKACGATPVTAPEVDL-TANVDNLL 143 ***************************************************999997766.6999**** PP TIGR01141 138 eaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnl 202 +a++ ++k+ fla+PnnPtG++l + e+ ++ + +d l V+D AY+eF ++ +el++ +n+ lcl|NCBI__GCF_000009985.1:WP_011386328.1 144 AAVTPRTKILFLANPNNPTGTYLPATEVARLRAGLrADILLVIDAAYTEFVSRndySGGIELVEAGDNV 212 ***********************************66**************997766789********* PP TIGR01141 203 vvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkere 271 vv rT+SK+++L+glR+G a++ ++++ +l++vr+p+nv +al+a++aa +d ++ e + ++ lcl|NCBI__GCF_000009985.1:WP_011386328.1 213 VVCRTFSKMYALGGLRLGWAYCPENVAGVLNRVRNPFNVGAPALAAGLAAFNDTAYAELCKSHNDYWLP 281 ********************************************************************* PP TIGR01141 272 rlleelkkleglevyeSkaNFvlikvke....daeelleallekgiivRdlksaeglleeclRitvGtr 336 +l +l++l gl v++S NF+l+++++ da ++ + l kgiivR ++ + gl +clRit+Gt lcl|NCBI__GCF_000009985.1:WP_011386328.1 282 WLSGQLAEL-GLTVVPSVCNFILVRFPKdagkDAGAADKFLRSKGIIVRAMGGY-GL-GDCLRITIGTG 347 *********.8****************9888888888889999***********.85.*********** PP TIGR01141 337 eenerllealke 348 een+ +++alke lcl|NCBI__GCF_000009985.1:WP_011386328.1 348 EENQLVVAALKE 359 **********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.09 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory