GapMind for Amino acid biosynthesis


Aligments for a candidate for leuB in Magnetospirillum magneticum AMB-1

Align 3-isopropylmalate dehydrogenase (EC (characterized)
to candidate WP_011386420.1 AMB_RS20570 3-isopropylmalate dehydrogenase

Query= BRENDA::P24404
         (370 letters)

>lcl|NCBI__GCF_000009985.1:WP_011386420.1 AMB_RS20570
           3-isopropylmalate dehydrogenase
          Length = 369

 Score =  429 bits (1103), Expect = e-125
 Identities = 214/370 (57%), Positives = 277/370 (74%), Gaps = 1/370 (0%)

           M  + L +LPGDGIG E M +VR++I++M       F ++EGL+GG+AYD HG       


           LK E+V GLDI+I+RELTGG+YFG+P+ I  L +G ++G +T +Y T EI+RI  VAF+L

           AR R+ ++CS++K NV++  VLW + + +    ++ DV+L HM  D   MQLVR PKQFD



Query: 361 VLAEFKALSA 370
           V+ E   L+A
Sbjct: 360 VVRELDKLNA 369

Lambda     K      H
   0.319    0.135    0.387 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 434
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 370
Length of database: 369
Length adjustment: 30
Effective length of query: 340
Effective length of database: 339
Effective search space:   115260
Effective search space used:   115260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate WP_011386420.1 AMB_RS20570 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00169.hmm
# target sequence database:        /tmp/gapView.25875.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00169  [M=349]
Accession:   TIGR00169
Description: leuB: 3-isopropylmalate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   2.4e-150  486.3   0.0   2.8e-150  486.1   0.0    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011386420.1  AMB_RS20570 3-isopropylmalate de

Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011386420.1  AMB_RS20570 3-isopropylmalate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  486.1   0.0  2.8e-150  2.8e-150       2     348 ..       6     359 ..       5     360 .. 0.98

  Alignments for each domain:
  == domain 1  score: 486.1 bits;  conditional E-value: 2.8e-150
                                 TIGR00169   2 iavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlga 70 
                                               + +LpGDgiG ev+a+  ++++ +  + ++++e  e l+GGaa d +g+P p+etl+a+ +adavLlga
                                               679****************************************************************** PP

                                 TIGR00169  71 vGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYf 139
                                               vGGpkWd+lp d++Pe+gLL +rk+++lfanLrPa++ ++L ++s+lk+e+v+g+D++++reLtgG+Yf
                                               ********************************************************************* PP

                                 TIGR00169 140 Gepkereeaee.ekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiak 207
                                               G+p++++   + ++k+++t +Yt++ei+ri rvaf larkr+kk++svDkanvLe + lWr+ + +++k
                                               ******9987779*************************************************9999988 PP

                                 TIGR00169 208 .eyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslss.....kgl 270
                                                e+Pdvel h+y+DnaamqLv++P+q+dv+vt+n+fGDilsD a+++tGslG+LPsasl++     k++
                                               8************************************************************99999999 PP

                                 TIGR00169 271 alfepvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseatta 339
                                               al+epvhgsapdiagk++anp+a+i+s a+ lrys+++  +a+ ie+avk+vl+ g rt+d+++ + ++
                                               ********************************************************************* PP

                                 TIGR00169 340 vstkeveee 348
                                               vst+ ++e 
  lcl|NCBI__GCF_000009985.1:WP_011386420.1 351 VSTTVMGEA 359
                                               ****99986 PP

Internal pipeline statistics summary:
Query model(s):                            1  (349 nodes)
Target sequences:                          1  (369 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 10.59

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory