Align 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; Short=OFOR1; EC 1.2.7.11 (characterized, see rationale)
to candidate WP_011384545.1 AMB_RS10845 2-oxoglutarate synthase
Query= uniprot:OFOB1_AERPE (318 letters) >NCBI__GCF_000009985.1:WP_011384545.1 Length = 279 Score = 189 bits (480), Expect = 7e-53 Identities = 92/229 (40%), Positives = 143/229 (62%), Gaps = 4/229 (1%) Query: 2 ASRGVASYRTEVWSDWCPGCGDFGILAAMQKAFAELNLDPAQTVVVSGIGCSSKTPHFIN 61 A+ ++++V WCPGCGD+ +L+++ KAFA+L L P +T VVSGIGCSS+ P + N Sbjct: 8 ATYAAKDFKSDVKPVWCPGCGDYAVLSSITKAFADLGLKPHETSVVSGIGCSSRIPAYTN 67 Query: 62 VNGVHTIHGRGIAFATGIKLANPQLKVIVNGGDGDLLGIGVAHFVALGRRNLDVTVLIHN 121 G+H+IHGR +A G+KLA P L V+V GGDGD IG HF+ RRN+D+T ++ + Sbjct: 68 TYGIHSIHGRALAVGQGLKLARPDLTVMVAGGDGDGFSIGGNHFLHACRRNVDLTYIVMD 127 Query: 122 NKVYGLTKGQASPTLRRGEKVKSLPVP--NLQDAVNPIALAIASGYTFVARAYSLWVDHL 179 N+VYG+TKGQ SPT ++ P +P+A+A+ASG F+AR +S + Sbjct: 128 NRVYGMTKGQPSPTTESDWDASAMAPPGGTGMTPFHPLAIALASGANFIARGFSGDPNGT 187 Query: 180 KEILKAAINHKGSAVIDVLQPCVTYNDIYTAEFYKDRLYKLEDDPSWDP 228 +I+ AI H G + + ++ PC+T+ + +K+ + + +P+ DP Sbjct: 188 AQIIAEAIRHPGFSFVAIMSPCITFRE--EQRDWKNTMRNVNIEPTTDP 234 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 279 Length adjustment: 26 Effective length of query: 292 Effective length of database: 253 Effective search space: 73876 Effective search space used: 73876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory