Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_011382609.1 AMB_RS00825 NAD(+) kinase
Query= BRENDA::A3DDM2 (289 letters) >NCBI__GCF_000009985.1:WP_011382609.1 Length = 255 Score = 66.2 bits (160), Expect = 7e-16 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 6/149 (4%) Query: 59 SDVMVCLGGDGTFLKAARMTVVKGKPLLGVNLGKLGFLADVDKNDIENAVKRLVEDKFTV 118 +DV++ LGGDG L+ V + P+ G+N G +GFL +V + ++RL + + + Sbjct: 35 ADVIIALGGDGFMLETLHRFVDRRVPIYGMNRGSVGFLMNVYRE--HGLIERLSKAEEVI 92 Query: 119 DERMMLDTVIVRDGKIIAEDIVLNDVVISRGAISRILHLKTYINDAF-MDLYPGDGLIIS 177 + + ++ E + +N+V + R + L+ I+ MD DG+++S Sbjct: 93 LHPLRMKARTASGEEV--EALAINEVSLLRET-RQAAKLRIRIDGKIRMDELICDGILLS 149 Query: 178 TPTGSTAYSLSAGGPLVEPDVDLIICTPI 206 TP GSTAY+LSA GP++ + TPI Sbjct: 150 TPAGSTAYNLSAHGPIIPLGAGIAALTPI 178 Lambda K H 0.320 0.140 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 255 Length adjustment: 25 Effective length of query: 264 Effective length of database: 230 Effective search space: 60720 Effective search space used: 60720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory