Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate WP_011386227.1 AMB_RS19595 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Query= SwissProt::P56220 (274 letters) >NCBI__GCF_000009985.1:WP_011386227.1 Length = 280 Score = 341 bits (875), Expect = 9e-99 Identities = 182/275 (66%), Positives = 214/275 (77%), Gaps = 8/275 (2%) Query: 4 LQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEK-IDGQWVTHQWLKKA 62 L+ I++A+E R I V R+AV + LDSG+LRVA K DG+WV +QWLKKA Sbjct: 6 LEKTIDAAWEARDGINLQTKGEV-RDAVEAALDALDSGSLRVAAKGDDGKWVVNQWLKKA 64 Query: 63 VLLSFRINDNKVM-DGAETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIARNT 121 VLLSFR++DNKVM DG T ++DKVP KF +D++RF+ GFR VP A VR+ A+IA Sbjct: 65 VLLSFRLSDNKVMGDGPGTTWFDKVPTKFEGWDDSRFRAAGFRAVPGAVVRRSAYIAPGV 124 Query: 122 VLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDN 181 VLMPS+VN+GA+V GTMVDTWATVGSCAQIGKNVH+SGG GIGGVLEPLQA P IIEDN Sbjct: 125 VLMPSFVNLGAHVGSGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIEDN 184 Query: 182 CFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPSK 241 CFIGAR+EV EGVIVE G+V+SMGVY+G ST+I DRETGEI GRVPA SVVVSG +P K Sbjct: 185 CFIGARAEVAEGVIVETGAVLSMGVYIGASTKIVDRETGEIFMGRVPAYSVVVSGTMPGK 244 Query: 242 ---DGS--YSLYCAVIVKKVDAKTRGKVGINELLR 271 DG+ LYCAVIVK+VD +TR KVGINELLR Sbjct: 245 PFPDGTPGPGLYCAVIVKRVDERTRSKVGINELLR 279 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 280 Length adjustment: 25 Effective length of query: 249 Effective length of database: 255 Effective search space: 63495 Effective search space used: 63495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_011386227.1 AMB_RS19595 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.6303.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-131 422.3 0.2 4.8e-131 422.1 0.2 1.0 1 lcl|NCBI__GCF_000009985.1:WP_011386227.1 AMB_RS19595 2,3,4,5-tetrahydropy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009985.1:WP_011386227.1 AMB_RS19595 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransfer # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.1 0.2 4.8e-131 4.8e-131 2 269 .. 6 279 .. 5 280 .] 0.95 Alignments for each domain: == domain 1 score: 422.1 bits; conditional E-value: 4.8e-131 TIGR00965 2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekl.dgqwkvnewvkkavllsfritd 69 l k i+ a+e r+ i + + +v++av+ ++ ldsg lrva k dg+w+vn+w+kkavllsfr++d lcl|NCBI__GCF_000009985.1:WP_011386227.1 6 LEKTIDAAWEARDGINLQT-KGEVRDAVEAALDALDSGSLRVAAKGdDGKWVVNQWLKKAVLLSFRLSD 73 6799*********998765.5799*********************8799******************** PP TIGR00965 70 nqvlnda.vnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtm 137 n+v+ d+ + +fdkv+tkf +d+++f+ ag+r+vpgavvrr a+ia vvlmps+vn+ga+v gtm lcl|NCBI__GCF_000009985.1:WP_011386227.1 74 NKVMGDGpGTTWFDKVPTKFEGWDDSRFRAAGFRAVPGAVVRRSAYIAPGVVLMPSFVNLGAHVGSGTM 142 ****8872578********************************************************** PP TIGR00965 138 vdtwatvgscaqigknvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvfi 206 vdtwatvgscaqigknvh+sgg+giggvleplqa pviiedncfigar+e++egvive g+v+smgv+i lcl|NCBI__GCF_000009985.1:WP_011386227.1 143 VDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIEDNCFIGARAEVAEGVIVETGAVLSMGVYI 211 ********************************************************************* PP TIGR00965 207 gqstkivdretgeiiygrvpagsvvvsgslpsk...dgk..kslycavivkkvdaktrgkvsinellr 269 g stkivdretgei+ grvpa+svvvsg++p k dg ++lycavivk+vd++tr+kv+inellr lcl|NCBI__GCF_000009985.1:WP_011386227.1 212 GASTKIVDRETGEIFMGRVPAYSVVVSGTMPGKpfpDGTpgPGLYCAVIVKRVDERTRSKVGINELLR 279 *******************************864557872258************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (280 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory