Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_011382998.1 AMB_RS02875 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_000009985.1:WP_011382998.1 Length = 400 Score = 472 bits (1214), Expect = e-137 Identities = 231/395 (58%), Positives = 292/395 (73%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKY 74 A R+S+I S + + +AA +K G+ VI LGAGEPDFDTP+++K AA AI +G TKY Sbjct: 5 ADRLSAIKPSPTIAVTQKAAELKAAGRDVIGLGAGEPDFDTPDNIKAAAKAAIDKGLTKY 64 Query: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPY 134 GT +L++AI KF+RENGL Y D++TV G K ++FNA MA+++PGDEVI+P PY Sbjct: 65 GPPAGTVDLRQAIAAKFKRENGLDYTADQVTVGVGGKGVIFNAFMATINPGDEVIVPAPY 124 Query: 135 WTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 W SY DI + GKPV + C ++GF+L LE AITPRT+W++LNSPSNP+GAAYS Sbjct: 125 WVSYPDIALMFGGKPVFVPCPETAGFKLQPADLEKAITPRTKWLVLNSPSNPTGAAYSWD 184 Query: 195 DYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMT 254 + + L +VLLRHPHVW++ DDMYEH+VYD F+F TPAQ+EP L +RTLT+NGVSKAYAMT Sbjct: 185 EMKALTDVLLRHPHVWIMSDDMYEHLVYDDFKFCTPAQVEPKLYDRTLTMNGVSKAYAMT 244 Query: 255 GWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDL 314 GWR+GYA GP +IKA+ ++QSQ+ + SSISQAASV ALNG QDF+ + F+RRRDL Sbjct: 245 GWRVGYAAGPAAIIKAINMIQSQSVTHTSSISQAASVEALNGTQDFIPKNAAVFKRRRDL 304 Query: 315 VVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVP 374 +V LN G+ CR PEGAFY + CAGV+GK TP GK I DTDF LLE VAVV Sbjct: 305 IVGLLNQCPGITCRTPEGAFYVYPSCAGVIGKKTPDGKVIANDTDFVGALLEAEGVAVVQ 364 Query: 375 GSAFGLSPFFRISYATSEAELKEALERIAAACDRL 409 G+AFGL P+FRISYATS+A L +A ERI C+ L Sbjct: 365 GAAFGLEPYFRISYATSDAALTKAAERIKRFCESL 399 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 400 Length adjustment: 31 Effective length of query: 379 Effective length of database: 369 Effective search space: 139851 Effective search space used: 139851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory