Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate 7023223 Shewana3_0457 response regulator receiver protein (RefSeq)
Query= reanno::psRCH2:GFF85 (317 letters) >FitnessBrowser__ANA3:7023223 Length = 318 Score = 446 bits (1147), Expect = e-130 Identities = 235/318 (73%), Positives = 265/318 (83%), Gaps = 2/318 (0%) Query: 1 MRLTKRLGLLAAAAAFTASTAAVAA-PTFINILTGGTSGVYYPIGVALSQQYNK-IDGAK 58 M++ KR + AA + S A++AA P FINILTGGTSGVYYPIGVALSQ Y I+GAK Sbjct: 1 MKINKRFIAVGAALTLSLSAASMAAAPAFINILTGGTSGVYYPIGVALSQLYGSGIEGAK 60 Query: 59 TSVQATKASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNY 118 TSVQATKASVENLNLLQAGRGELA +LGDSV A+ G DAGFK PL ++R +A Y NY Sbjct: 61 TSVQATKASVENLNLLQAGRGELALALGDSVAAAYQGDADAGFKKPLDKVRVLAAAYPNY 120 Query: 119 IQIVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAES 178 IQIVA+ ESGIKTL DLKGKRISVGAPKSGTELNARAIFKAAGL Y+DMG+VEFLPYAES Sbjct: 121 IQIVANKESGIKTLADLKGKRISVGAPKSGTELNARAIFKAAGLSYEDMGKVEFLPYAES 180 Query: 179 VELIKNRQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKIESDAYLAGVIPAGTY 238 VELIKNRQLDATLQSSGLGMAAIRDLA+TMP+ FVEIP +V+ KI + AY GVIPA TY Sbjct: 181 VELIKNRQLDATLQSSGLGMAAIRDLAATMPINFVEIPEDVIGKINNPAYQHGVIPAATY 240 Query: 239 DGQDADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDIKLENATKNL 298 +GQ ADV TVAI N+ VT VSD++AYQMTKLMF++L LGNAHSAAK I+L+ ATKNL Sbjct: 241 EGQTADVSTVAIQNLFVTQAGVSDDLAYQMTKLMFEHLDRLGNAHSAAKAIQLDKATKNL 300 Query: 299 PIPLHPGAERFYKEAGVL 316 P PLHPGAER++KE G L Sbjct: 301 PAPLHPGAERYFKEVGAL 318 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 318 Length adjustment: 27 Effective length of query: 290 Effective length of database: 291 Effective search space: 84390 Effective search space used: 84390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory