Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate 7024209 Shewana3_1416 TRAP dicarboxylate transporter, DctP subunit (RefSeq)
Query= reanno::SB2B:6938088 (339 letters) >FitnessBrowser__ANA3:7024209 Length = 340 Score = 525 bits (1352), Expect = e-154 Identities = 258/327 (78%), Positives = 291/327 (88%) Query: 12 LFTLGKASLLATVLGFSFGAVAEPVEIKFSHVVAENTPKGQMALKFKELVESRLPGEYKV 71 L T+ K LA+V SF A PVEIKFSHVVAENTPKGQMALKFKELVE RLPGEY V Sbjct: 13 LKTVAKMLALASVFATSFNVFAAPVEIKFSHVVAENTPKGQMALKFKELVEQRLPGEYTV 72 Query: 72 SVFPNSQLFGDNNELAALLLNDVQLVAPSLSKFERYTKKLQVFDLPFLFEDMDAVDRFQQ 131 SVFPNSQLFGDNNELAALLLNDVQ VAPSLSKFERYTK+LQVFDLPFLF DMDAV+RFQQ Sbjct: 73 SVFPNSQLFGDNNELAALLLNDVQFVAPSLSKFERYTKRLQVFDLPFLFNDMDAVNRFQQ 132 Query: 132 SEAGQQLLNSMSRKGLVGLGYLHNGMKQFSANNALSLPGDAAGKKFRIMPSDVIAAQFEA 191 EAGQ LLNSMSRKG+VGLGYLHNGMKQFSAN L P DA G KFR+M SDV+AAQF+A Sbjct: 133 GEAGQALLNSMSRKGIVGLGYLHNGMKQFSANTPLKQPSDAKGLKFRVMASDVLAAQFDA 192 Query: 192 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQTHITESNHGVLDYMLVTSE 251 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSN YS+KFYEVQ+ ITESNHGVLDYM+VTS+ Sbjct: 193 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSNTYSQKFYEVQSQITESNHGVLDYMVVTSD 252 Query: 252 TFWKSLPKDKREIIKQSMDEAVALGNKLALEKANEDRQLILDSKRVELVTLTPEQRQAWV 311 FWKSLP DKR++IK+++DE++ALGNK+A EK NED+QLILDSKR +LVTLTP++RQ W+ Sbjct: 253 AFWKSLPADKRKVIKEALDESIALGNKIAAEKDNEDKQLILDSKRSQLVTLTPDERQKWI 312 Query: 312 NAMRPVWSQFEDKIGKDLIEAAESANK 338 + M+PVW++FED++GKD+IEAA +ANK Sbjct: 313 DVMKPVWAKFEDQVGKDVIEAAVAANK 339 Lambda K H 0.316 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 340 Length adjustment: 28 Effective length of query: 311 Effective length of database: 312 Effective search space: 97032 Effective search space used: 97032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory