Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate 7025617 Shewana3_2768 enoyl-CoA hydratase (RefSeq)
Query= CharProtDB::CH_091794 (261 letters) >FitnessBrowser__ANA3:7025617 Length = 257 Score = 168 bits (426), Expect = 9e-47 Identities = 95/251 (37%), Positives = 141/251 (56%), Gaps = 2/251 (0%) Query: 11 EGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISE 70 EG A++T+N P A N + +L+ + + E+ + ++ A++LTG G K F AGAD+ Sbjct: 9 EGHTAILTMNNPPA-NTWTAQSLQALKAKVLELNANKDIYALVLTGEGNKFFSAGADLKL 67 Query: 71 MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARF 130 + + + F L IAA+NG+A+GGG E+A++CDIRIA + A Sbjct: 68 FSDGDKGNAASMAKHFGEAFETLSQFRGVSIAAINGYAMGGGLEVALACDIRIAETQAVM 127 Query: 131 GQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMN 190 PE +G+ P GGTQ L+ LVG G AK++I + + A +AL + LV +VVE E +N Sbjct: 128 ALPEATVGLLPCAGGTQNLTALVGEGWAKRMILCGERVNAAQALNLRLVEEVVETGEALN 187 Query: 191 TAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFI 250 A +A K+ + +P +V K I G Q AL E E F F TEDQ + + AF+ Sbjct: 188 AAIALAAKVANQSPSSVTACKTLIQAGRQMPRSQALPIERELFVGLFDTEDQAEGVNAFL 247 Query: 251 EKRKIEGFKNR 261 EKRK + +KNR Sbjct: 248 EKRKAD-WKNR 257 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 257 Length adjustment: 24 Effective length of query: 237 Effective length of database: 233 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory