GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagP in Shewanella sp. ANA-3

Align N-acetylglucosamine porter, NagP (characterized)
to candidate 7025545 Shewana3_2696 major facilitator transporter (RefSeq)

Query= TCDB::Q8EBL0
         (435 letters)



>lcl|FitnessBrowser__ANA3:7025545 Shewana3_2696 major facilitator
           transporter (RefSeq)
          Length = 452

 Score =  416 bits (1069), Expect = e-121
 Identities = 226/431 (52%), Positives = 296/431 (68%), Gaps = 16/431 (3%)

Query: 9   KSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALPS 68
           + SF+PM ++  LFF+ GF TWLNG+L+P+LK   QLN F+A L+ F FYIA    ALP+
Sbjct: 15  QGSFIPMLLIGILFFVFGFVTWLNGALIPFLKIACQLNEFEAYLVTFVFYIAYFVMALPT 74

Query: 69  AWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTLLQTAVNPY 128
           + ++ ++GYK GM LG+G+M     LFI AA    FA FL A  V+G G TLLQTA NPY
Sbjct: 75  SSILTRLGYKMGMTLGLGIMAAGAGLFIVAALVGHFATFLLALFVLGTGLTLLQTAANPY 134

Query: 129 VVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLT-------QVQI 181
           +V +GP ESAA R+S+MGI+NKGAG I P++F+A IL   +    T L        Q+ +
Sbjct: 135 IVCIGPRESAAMRISLMGIVNKGAGFIVPIIFTAWILTGMEPYSETALASLSEAQRQLAL 194

Query: 182 DEMANGLVLPYLGMA-VFIGILALAVKKSPLPELSNEDEVADHTDKSQI--KAALSHPNL 238
            E+AN LV PYL M  V +G++A  V  SPLPE     E+ +  +++Q   KA L +P +
Sbjct: 195 TELANRLVHPYLMMMLVLLGLMAF-VWFSPLPE----PELGERVERTQTDWKAILQYPQV 249

Query: 239 ALGVLALFVYVAVEVIAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVIS 298
            LG L LF YV  EVIAGD+IG F+  LG+ H+G+MTSYTM  MVLGY+LGILLIPR IS
Sbjct: 250 ILGALTLFCYVGAEVIAGDSIGLFSQGLGVAHFGMMTSYTMGFMVLGYVLGILLIPRWIS 309

Query: 299 QPTALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVW 358
           Q TAL+ SAI GLL TLG+L  D+ S A++ LLL   G + +PD +L +A LGLANA+VW
Sbjct: 310 QQTALVGSAIAGLLFTLGVLLSDSQSQALSELLLGWLGVLPVPDPVLYLALLGLANALVW 369

Query: 359 PAVWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLF 418
           PAVWPLAL G+G+LT+T SALLIMGIAGGA  P+ +G ++ +    Q   Y ++LPCY  
Sbjct: 370 PAVWPLALEGLGRLTATASALLIMGIAGGAILPLLYGYIAHSQGDSQM-AYFLLLPCYGL 428

Query: 419 ILFYAVKGHKM 429
           I +YA+ GHK+
Sbjct: 429 IFYYAIWGHKL 439


Lambda     K      H
   0.326    0.141    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 771
Number of extensions: 35
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 435
Length of database: 452
Length adjustment: 32
Effective length of query: 403
Effective length of database: 420
Effective search space:   169260
Effective search space used:   169260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory