GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adiA in Shewanella sp. ANA-3

Align arginine decarboxylase (EC 4.1.1.19) (characterized)
to candidate 7024446 Shewana3_1624 arginine decarboxylase (RefSeq)

Query= BRENDA::Q7MK24
         (640 letters)



>lcl|FitnessBrowser__ANA3:7024446 Shewana3_1624 arginine
           decarboxylase (RefSeq)
          Length = 637

 Score =  891 bits (2302), Expect = 0.0
 Identities = 436/631 (69%), Positives = 523/631 (82%), Gaps = 1/631 (0%)

Query: 11  LDRVRADYNVHYWSQGFYGIDDQGEMYVSPRSDNA-HQIQLSKIVKQLEERQLNVPVLVR 69
           +D  RA YNV +WSQGFYGI DQGE+ VSP   N  H+I L+++ K + +  + +PVLVR
Sbjct: 6   IDAARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPDHKIGLNELAKDMVKAGVALPVLVR 65

Query: 70  FPQILHQRVHSICDAFNQAIEEYQYPNKYLLVYPIKVNQQREVVDEILASQAQLETKQLG 129
           FPQILH RV+S+C AF+QAI++Y+Y   YLLVYPIKVNQQ+ VV+EILASQA  E  QLG
Sbjct: 66  FPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQKTVVEEILASQASKEVPQLG 125

Query: 130 LEAGSKPELLAVLAMAQHASSVIVCNGYKDREYIRLALIGEKLGHKVFIVLEKMSELDLV 189
           LEAGSKPEL+AVLAMAQ ASSVIVCNGYKD EYIRLALIGEKLGHKV+IVLEK+SEL +V
Sbjct: 126 LEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLSELKMV 185

Query: 190 LREAKSLGVTPRLGIRIRLASQGAGKWQASGGEKSKFGLSASQVLNVISRLKKENQLDTL 249
           L E+K LGV PRLG+R RLA QG GKWQASGGEKSKFGLSA+Q+L V+ +LK+E+ LD+L
Sbjct: 186 LAESKRLGVKPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQEDMLDSL 245

Query: 250 QLVHFHLGSQMANIRDVRNGVNESARFYCELRTLGANITYFDVGGGLAIDYDGTRSQSSN 309
           QL+HFHLGSQ+ANIRD+R GV+E+ARFYCELR LGA+I  FDVGGGLA+DYDGTRSQS+N
Sbjct: 246 QLLHFHLGSQIANIRDIRQGVSEAARFYCELRELGASINCFDVGGGLAVDYDGTRSQSNN 305

Query: 310 SMNYGLVEYARNIVNTVGDVCKDYKQPMPVIISESGRSLTAHHAVLISNVIGTETYKPET 369
           SMNYGL EYA NIVN + D+C +Y+QPMP IISESGR LTAHHAVLI++VIGTE Y+ E 
Sbjct: 306 SMNYGLSEYANNIVNVLTDICNEYEQPMPRIISESGRHLTAHHAVLITDVIGTEAYQVEE 365

Query: 370 VTEPEEDFPLLLNNMWRSWLNLHNGTDARALIEIYNDTQSDLAEVHSQFATGVLTLEHRA 429
           +  P E+ P LL+NMW+SW  +    D RALIEIY+D+QSDL E  S FA G L+L  RA
Sbjct: 366 IQPPAEESPQLLHNMWQSWTEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERA 425

Query: 430 WAEQTSLRIYYELNRLMSTKNRFHRPILDELSERLADKFFVNFSLFQSLPDSWGIDQVFP 489
           WAEQ +LR+ +E+  L+STKNR+HRPI+DEL+E+LADKFFVNFSLFQSLPD+WGIDQVFP
Sbjct: 426 WAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGIDQVFP 485

Query: 490 VLPLSGLQNAADRRAVMLDITCDSDGAIDAYVDGQGIESTLPVPAWNEDEPYLMGFFLVG 549
           VLPLSGL  A +RRAVMLDITCDSDG +D YVDGQGIE+TLPVPAW+ + PYLMGFF+VG
Sbjct: 486 VLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLMGFFMVG 545

Query: 550 AYQEILGDMHNLFGDTHSVVVNVGDQGEINIDFINEGDTVEDMMRYVHIDVDQIRKNYHS 609
           AYQEILGDMHNLFGDT+S VV++ + G  NI+ +  GDTV D++RYV++D     + Y  
Sbjct: 546 AYQEILGDMHNLFGDTNSAVVSIEENGMTNIESVLAGDTVADVLRYVNLDAVDFMRTYEE 605

Query: 610 LVSQRVDQEEQQQILAELEQGLSGYTYLEDF 640
           LV+Q + +EE+ QIL EL+ GL GYTYLEDF
Sbjct: 606 LVNQHIAEEERAQILEELQVGLKGYTYLEDF 636


Lambda     K      H
   0.318    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1155
Number of extensions: 44
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 640
Length of database: 637
Length adjustment: 38
Effective length of query: 602
Effective length of database: 599
Effective search space:   360598
Effective search space used:   360598
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

Align candidate 7024446 Shewana3_1624 (arginine decarboxylase (RefSeq))
to HMM TIGR01273 (speA: arginine decarboxylase (EC 4.1.1.19))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01273.hmm
# target sequence database:        /tmp/gapView.27496.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01273  [M=624]
Accession:   TIGR01273
Description: speA: arginine decarboxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   1.3e-269  881.9   0.1   1.4e-269  881.7   0.1    1.0  1  lcl|FitnessBrowser__ANA3:7024446  Shewana3_1624 arginine decarboxy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024446  Shewana3_1624 arginine decarboxylase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  881.7   0.1  1.4e-269  1.4e-269       1     624 []       4     634 ..       4     634 .. 0.98

  Alignments for each domain:
  == domain 1  score: 881.7 bits;  conditional E-value: 1.4e-269
                         TIGR01273   1 wsaeesakvYnikgWgagyfavnkeGevsvrpkgeetlkeidllelvkqveakglklPllvrFpdilqkrikslnaa 77 
                                       ws++ +++ Yn+++W++g++ + ++Gev+v+p+ ++  ++i l el k++ ++g+ lP+lvrFp+il++r++sl++a
  lcl|FitnessBrowser__ANA3:7024446   4 WSIDAARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPDHKIGLNELAKDMVKAGVALPVLVRFPQILHHRVNSLCQA 80 
                                       78999999********************************************************************* PP

                         TIGR01273  78 FkeaieeleYaskyqavyPiKvnqqrevveelvasg....gkslGLEaGsKpEllialalaekpkavivcnGyKDre 150
                                       F++ai+++eY+++y +vyPiKvnqq++vvee++as+      +lGLEaGsKpEl+++la+a+k+++vivcnGyKD+e
  lcl|FitnessBrowser__ANA3:7024446  81 FDQAIQKYEYQADYLLVYPIKVNQQKTVVEEILASQaskeVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNE 157
                                       **********************************9986434589********************************* PP

                         TIGR01273 151 yielaliarklglkvviviekleEldlvieeakklgvkPklGlRvrLaskgsgkwassgGeksKFGLsasqvlevvk 227
                                       yi+lali++klg+kv+iv+ekl+El++v++e+k+lgvkP+lGlR+rLa +g gkw+ sgGeksKFGLsa+q+l+vv+
  lcl|FitnessBrowser__ANA3:7024446 158 YIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVD 234
                                       ***************************************************************************** PP

                         TIGR01273 228 klkeedlldslkllHfHlGsqianiddvkkgvrEaarlyvelrklGvkievvdvGGGLgvdYdGtksksdlsvnYsl 304
                                       +lk+ed+ldsl+llHfHlGsqiani+d+++gv+Eaar+y+elr+lG++i+++dvGGGL+vdYdGt+s+s++s+nY+l
  lcl|FitnessBrowser__ANA3:7024446 235 QLKQEDMLDSLQLLHFHLGSQIANIRDIRQGVSEAARFYCELRELGASINCFDVGGGLAVDYDGTRSQSNNSMNYGL 311
                                       ***************************************************************************** PP

                         TIGR01273 305 eeyaaavvaalkevceekgvpePviisEsGRaitahhavlvaevleveeeeeeeaeeileeeapeevk....eleel 377
                                        eya+++v +l ++c+e+++p P+iisEsGR +tahhavl+++v+++e+++ ee++ ++e e+p++++    +++e+
  lcl|FitnessBrowser__ANA3:7024446 312 SEYANNIVNVLTDICNEYEQPMPRIISESGRHLTAHHAVLITDVIGTEAYQVEEIQPPAE-ESPQLLHnmwqSWTEI 387
                                       ***************************************************998777666.99999998887899** PP

                         TIGR01273 378 lkeideesaeelledavqlleeavelfklGkldleeralaeqlalailkkvke.leakekshreildelqeklaeky 453
                                       ++ +d+++++e+++d++++l+ea +lf+lG+l+l+era+aeq  l+++++v+  l++k++ hr+i+del+ekla+k+
  lcl|FitnessBrowser__ANA3:7024446 388 SGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERAWAEQANLRVCHEVQGlLSTKNRYHRPIIDELNEKLADKF 464
                                       *****************************************************99********************** PP

                         TIGR01273 454 lvnlslFqslPDaWgidqlfPilPlerLdekpdrravllDltCDsDGkikkfveeqgiektlplheldkdeeyllgf 530
                                       +vn+slFqslPDaWgidq+fP+lPl++Ld++p+rrav+lD+tCDsDG ++++v++qgie+tlp+++++ + +yl+gf
  lcl|FitnessBrowser__ANA3:7024446 465 FVNFSLFQSLPDAWGIDQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLMGF 541
                                       ***************************************************************************** PP

                         TIGR01273 531 flvGAYqEiLgdvHnLFgdteavevvvkekgeveveaieegdtvedvlkavqydpeellkalkqkvaeaklkaeekk 607
                                       f+vGAYqEiLgd+HnLFgdt+++ v ++e+g +++e++  gdtv+dvl++v++d+ + ++++++ v++ ++++ee++
  lcl|FitnessBrowser__ANA3:7024446 542 FMVGAYQEILGDMHNLFGDTNSAVVSIEENGMTNIESVLAGDTVADVLRYVNLDAVDFMRTYEELVNQ-HIAEEERA 617
                                       *****************************************************************998.59****** PP

                         TIGR01273 608 qvlelleaglsgypYLs 624
                                       q+le+l++gl+gy+YL+
  lcl|FitnessBrowser__ANA3:7024446 618 QILEELQVGLKGYTYLE 634
                                       ***************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (624 nodes)
Target sequences:                          1  (637 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.02s 00:00:00.05 Elapsed: 00:00:00.04
# Mc/sec: 8.30
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory