GapMind for catabolism of small carbon sources

 

Aligments for a candidate for artQ in Shewanella sp. ANA-3

Align Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate 7023652 Shewana3_0881 polar amino acid ABC transporter, inner membrane subunit (RefSeq)

Query= TCDB::Q9HU30
         (231 letters)



>lcl|FitnessBrowser__ANA3:7023652 Shewana3_0881 polar amino acid ABC
           transporter, inner membrane subunit (RefSeq)
          Length = 226

 Score =  102 bits (254), Expect = 6e-27
 Identities = 63/210 (30%), Positives = 107/210 (50%), Gaps = 12/210 (5%)

Query: 12  LLAGTWMTLKLSLAAVCVGLLLGLLGAIAKTSKYAALRFLGGTYTTIVRGVPETLWVLMI 71
           +L G  +TL ++  A+ +G +LG+   + K S    +RF    Y  ++RG P  + ++++
Sbjct: 24  ILNGLKVTLIVTFFAMLLGAVLGVGTTLMKMSSKWYIRFPAELYVGVIRGTPVVVQLVIL 83

Query: 72  YFGTVSGLNALGDLFGKPDLALSPFAAGTLALGLCFGAYATEVFRGALLSIPRGHREAGQ 131
           YF  ++  +            +    A  +A GL  GAY +E+ R  + ++ +G  EA +
Sbjct: 84  YFIVLAAFD------------VDKVTAAIIAFGLNSGAYISEIIRAGIQAVDKGQTEAAR 131

Query: 132 ALGLSPGRIFWRIVLPQIWRVALPGLGNLYLILLKDTALVSLITLDEIMRKAQVASNATK 191
           +LGLS       I+LPQ  +  LP LGN +++LLK+TA++  I   ++MR  ++  + T 
Sbjct: 132 SLGLSQAMTMKLIILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLMRAGEIIRSRTF 191

Query: 192 EPFTFYMTAAAIYLSLTVVIMVALHFLERR 221
           E      T A IYL LT      L   E+R
Sbjct: 192 EDSIPLFTCALIYLFLTYSFTFMLSKFEKR 221


Lambda     K      H
   0.327    0.143    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 95
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 231
Length of database: 226
Length adjustment: 23
Effective length of query: 208
Effective length of database: 203
Effective search space:    42224
Effective search space used:    42224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory