Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate 7026102 Shewana3_3244 FAD dependent oxidoreductase (RefSeq)
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >FitnessBrowser__ANA3:7026102 Length = 491 Score = 142 bits (359), Expect = 2e-38 Identities = 120/409 (29%), Positives = 182/409 (44%), Gaps = 53/409 (12%) Query: 22 PALQDDVETDVCVIGAGYTGLSSALFL--LENGFKVTVLEAAKVGFGASGRNGGQIVNSY 79 P L+ D+ DV +IGAGY+GL +A +L + V +LEA +G GASGRNGG ++ S+ Sbjct: 21 PPLEQDITADVAIIGAGYSGLWTAYYLKQYQPNLSVVILEAEYIGQGASGRNGGWLMGSF 80 Query: 80 SRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGGVF--AALTAKQMG 137 S D+ + R G +Q + + E + AK+ I CDL GG AA +Q+ Sbjct: 81 SGDVAYLNRLEG-EQRLIAKAIIQETISEVATVCAKHHIDCDLHHGGNLRVAARYPEQLA 139 Query: 138 HLESQKRLW--ERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHPLNLALGEAAA 195 +++++ W + FG + LD+ + + V+ E + IHP L G A Sbjct: 140 NIKAELAQWRADGFGEEDIRWLDKTELDKQVSMAEGQAALFTPHCARIHPAKLVCGLADL 199 Query: 196 VESLGGVIYEQSPAVRIER--GASPVVHTPQGKVRAKFIIVAGNAYLGNLVPELAAKSMP 253 V+SLG IYE++ + A + TPQG VRA ++ A YL L L ++P Sbjct: 200 VQSLGVKIYERTSVNHMAHLGDALTQLQTPQGNVRAAIVVPAVEGYLRQL-SGLGRFTLP 258 Query: 254 CGTQVIATEPLGDELAHSL-LPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVYGARDPAN 312 + +IATEPL + ++ L D + ++ Y + + D RLIFG YG Sbjct: 259 VQSLLIATEPLTNVTWDAIGLANRATFSDASRIVTYGQRSPDNRLIFGARGGYGFGAKIR 318 Query: 313 IEAIIRPK---------------------------MLKAFPQLKDVKIDYAWTGNFLLTL 345 E PK +L FPQLK V+I + W G L Sbjct: 319 TEFGFDPKLFNGKFPVNQSPPQCAFEGEFGFRYQLLLALFPQLKGVQITHGWGGTLALAR 378 Query: 346 SRLPQ--------VGRLGDNIYYSQGCSGHGVTYTHLAGKVLAEALRGQ 386 P +G +G G G GV +L + L + + G+ Sbjct: 379 RFAPHAIFDQSLGLGLIG-------GYGGEGVGAANLFARTLVDLILGR 420 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 491 Length adjustment: 33 Effective length of query: 394 Effective length of database: 458 Effective search space: 180452 Effective search space used: 180452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory