Align L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (characterized)
to candidate 7023012 Shewana3_0250 aldehyde dehydrogenase (RefSeq)
Query= BRENDA::Q9K9B2 (515 letters) >FitnessBrowser__ANA3:7023012 Length = 506 Score = 218 bits (556), Expect = 3e-61 Identities = 151/430 (35%), Positives = 222/430 (51%), Gaps = 27/430 (6%) Query: 76 EKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEA-DADT 134 E A+ +A A W + ERAN+L++ A + + + E GK +E +AD Sbjct: 59 ELALDAAHAAKDAWGKTSVTERANLLLRIADRVEQNLEYLAVAETWENGKAVRETLNADL 118 Query: 135 AEAIDFLEYYARQMIELNRGKEILSRPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVA 194 +D Y+A I G + +F P+GV I PWNF L +M +A Sbjct: 119 PLFVDHFRYFAG-CIRAQEGSAADIDGNTVSYHFPEPLGVVGQIIPWNFPL-LMAAWKIA 176 Query: 195 P-IVTGNTVVLKPASTTPVVAAKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSL 253 P + GN VVLKPA TPV +E++ED LP G++N V G GAE G L + + Sbjct: 177 PALAAGNCVVLKPAEQTPVSILVLLELIEDL-LPPGILNVVNGFGAEAGQALATSKRIAK 235 Query: 254 ITFTGSKDVGVRLYERAAVVRPGQNHLKRVIVEMGGKDT------VVVDRDADLDLAAES 307 + FTGS +VG + + AA L VE+GGK V+ D LD A E Sbjct: 236 LAFTGSTEVGYHILKCAA------ESLIPSTVELGGKSPNLYFADVMDHEDEYLDKAVEG 289 Query: 308 ILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKA 367 +L++ F G+ C+ SR +I + +YD +EK +A A+ + G+P + +G ++ Sbjct: 290 MLLAFFN-QGEVCTCPSRVLIQESIYDRFIEKVLARAQTIKQGNPLDTATQVGAQASQEQ 348 Query: 368 FEKIMSYIEIGKKEG-RLMTGG-----EGDSSTGFFIQPTIIADLDPEAVIMQEEIFGPV 421 F+KI+SY+ IGK EG +++ GG EGD S G++I PTI+ + + I QEEIFGPV Sbjct: 349 FDKILSYLAIGKDEGAQVLLGGSLCQLEGDQSKGYYISPTIMKGHN-KMRIFQEEIFGPV 407 Query: 422 VAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQAKREFHVGNLYFNRNCTGAIVGY 481 ++ + D AL IAN+TEYGL V TR+ ++ R G ++ NC A + Sbjct: 408 ISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNRAQRLGRGIQAGRVWI--NCYHAYPAH 465 Query: 482 HPFGGFKMSG 491 FGG+K SG Sbjct: 466 AAFGGYKKSG 475 Lambda K H 0.316 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 506 Length adjustment: 35 Effective length of query: 480 Effective length of database: 471 Effective search space: 226080 Effective search space used: 226080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory