Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate 7023042 Shewana3_0280 ABC transporter related (RefSeq)
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__ANA3:7023042 Length = 367 Score = 131 bits (329), Expect = 3e-35 Identities = 90/228 (39%), Positives = 122/228 (53%), Gaps = 10/228 (4%) Query: 29 GEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKD------RNVTWEEPKDRGIGMVFQ 82 GE L ++G SG GK+TLL IAGL G I + ++ T P+ R IG + Q Sbjct: 29 GEVLAVVGPSGGGKTTLLRMIAGLNHPDAGSIVFGETLWFDHQSRTALTPQQRHIGYMPQ 88 Query: 83 SYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSELSGGQRQRV 142 + L+P +T +N+ GL IP +E R K E + + L R P LSGGQRQRV Sbjct: 89 HFGLFPNLTALENVVAGLD--HIPKSERIARAKDWLERVNLHGLPDRLPMHLSGGQRQRV 146 Query: 143 AIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHDQIEALTLAD 202 A+ RAL R+ V L DEP S +D + R L +E+ RL + L +I VTHD EAL LAD Sbjct: 147 ALARALAREPSVLLLDEPFSAVDRETRERLYLELARLKEQLLCPVIMVTHDLNEALLLAD 206 Query: 203 RIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNFFRGEVEPKD 250 + ++ G + Q P + + P N VA +G N F GEV +D Sbjct: 207 SMILISQGQMLQQGAPFEVLSRPRNEAVARQMG--LRNIFDGEVVFQD 252 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 367 Length adjustment: 29 Effective length of query: 332 Effective length of database: 338 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory