Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 7023651 Shewana3_0880 ABC transporter related (RefSeq)
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__ANA3:7023651 Length = 241 Score = 119 bits (297), Expect = 8e-32 Identities = 78/235 (33%), Positives = 132/235 (56%), Gaps = 14/235 (5%) Query: 26 VKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEIYFEGKDIWKDIKDRESLV 85 +K ++ +++ E+VS++G SGSGK+T + I L PT G+I EG+ I KD + Sbjct: 17 LKGINEHIRQGEVVSVIGPSGSGKSTFLRCINLLEKPTQGDIEIEGQSI--TAKDA-CVD 73 Query: 86 EFRRKVHAVFQDPFASYNPFYPVERTLWQAISL--LENKPSNKKEALELIKESLFRVGID 143 + R+KV VFQ+ +N F +T+ Q I+L + K + EA L +VG+ Sbjct: 74 KLRQKVGMVFQN----FNLF--PHKTVLQNITLAPVSLKLMTQAEADNKALALLTQVGL- 126 Query: 144 PKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKLLEELREE 203 +D YP +SGGQKQR+ IAR + P L++ DEPTS +D G ++ ++++L + Sbjct: 127 -QDKANAYPSSLSGGQKQRVAIARALAMEPDLMLFDEPTSALDPEMVGDVLDVMKDL-AQ 184 Query: 204 QGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVGSI 258 +G +++ +TH++G A VSD + M G +VE P+++ P T+ + + Sbjct: 185 KGMTMVIVTHEMGFARDVSDRVIFMDGGYVVESNIPEELFTRPKEARTQSFLSKV 239 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 241 Length adjustment: 24 Effective length of query: 244 Effective length of database: 217 Effective search space: 52948 Effective search space used: 52948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory