Align D-cellobiose transporter (MFS superfamily) (characterized)
to candidate 7024907 Shewana3_2081 sugar (glycoside-Pentoside-hexuronide) transporter (RefSeq)
Query= reanno::SB2B:6937231 (444 letters) >FitnessBrowser__ANA3:7024907 Length = 481 Score = 305 bits (782), Expect = 2e-87 Identities = 162/441 (36%), Positives = 250/441 (56%), Gaps = 3/441 (0%) Query: 2 LSVREKIAYGLGDTASNIVFQTVMLFLTFFYTDIFGISAAYVGTMFLAVRIMDAVTDPLM 61 LSV EKI YG GD A N+V ++ML +TFFYTDIFG+ A VG +FL VR++DA+TDPLM Sbjct: 6 LSVIEKIGYGSGDMAVNVVISSMMLIITFFYTDIFGLKPADVGILFLLVRLIDAITDPLM 65 Query: 62 GYLADRTNTRWGRYRPYLLWFAFPFAAISVLAFTTPDLSESGKEWYAFATYALLMLAYTA 121 G + D+ TRWGRYRPY L+ A PF L F+TPD + K +A++TY L+ + +T Sbjct: 66 GIINDKVTTRWGRYRPYFLFMAIPFGISVFLTFSTPDWDYNAKLIWAYSTYILVTIIFTT 125 Query: 122 INIPYCALGAALTTNPAERVSVQSYRFVFAMLGGVMVSALTLPLVDFFGQGDKAKGYQLT 181 + IPY ++ + +T +P ER+S YR FA + +V+ + L +G + A GYQ Sbjct: 126 VTIPYISIISVITDDPKERLSANGYRLFFAKIAAFLVTIIVPILASAWGGENIAAGYQKA 185 Query: 182 ILAMSIVGTVMFLLCFIGTKERDFSSDDNSGNFKAASKALWANDQWRVLSAAAIFLLTGL 241 + M+++ T++FL CF T ER + + + L+ NDQW VL A + G Sbjct: 186 MGVMALMATLLFLFCFFTTTER-VAYKVETKPVGMQLRLLFKNDQWLVLVAICVIGTIGY 244 Query: 242 VLKSTLAIYYVKYFLGRE-DMISVFVTSGVVGNIFGVALAKKLADKMCKVKAYIRLQLIA 300 V++ ++A YY Y+LG + M+S F+++GV I + + + + CK+K + Q++ Sbjct: 245 VIRGSVAAYYATYYLGGDAKMLSAFLSTGVGAAILAMVASTWITKRYCKLKLFRYSQIVV 304 Query: 301 AALCMAAWF-VPADQYVLALVFYIAWNFTINMGTPLLWAKMADTVDYGQFKTGVRTTGLV 359 L +F V VLA V Y A +F +++ P+ W+ ++++VDYG KTG R +GL Sbjct: 305 GILSAIMFFAVQPGDIVLAFVLYFAISFVVDLHAPVFWSVISESVDYGTVKTGHRVSGLA 364 Query: 360 YSSVIFFIKLGLAIGGALGGWLLAAYGYQPDVAQTEETRAGILLCFTLYPALASIAVAFV 419 + + F K G+ G + G LL + YQP Q+E GI L T+ P + + Sbjct: 365 FGGISFAQKAGMGAAGFVVGMLLTYFNYQPGETQSEFALTGISLMLTVIPGAFHALMGLL 424 Query: 420 MRHYTLDSQRVAEISVSLQQK 440 M Y + + EI +L ++ Sbjct: 425 MFKYKISDRVYEEIKQALPEQ 445 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 481 Length adjustment: 33 Effective length of query: 411 Effective length of database: 448 Effective search space: 184128 Effective search space used: 184128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory