Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate 7026098 Shewana3_3240 transport system permease protein (RefSeq)
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__ANA3:7026098 Length = 338 Score = 161 bits (407), Expect = 2e-44 Identities = 111/322 (34%), Positives = 170/322 (52%), Gaps = 10/322 (3%) Query: 15 VAALIIIFWLSLFCYSAIPVSGADATRALLP-------GHTPTLPEALVQNLRLPRSLVA 67 +A L+I+ L + +S D+ A+ G+ + +V N+RLPR+L+A Sbjct: 11 MATLLILSSLLSVSVGPVNISLIDSLSAVFNWATEQNIGNLAPHEQLVVSNVRLPRTLLA 70 Query: 68 VLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSLSFIAAC 127 + +GA LA G ++Q L NP+A P ++G++SGAAL A+ P +S A Sbjct: 71 LAVGAMLAQCGAVMQGLFRNPLADPGIIGVSSGAALGAAICIVQFPHA-ESVMISVSAFS 129 Query: 128 GGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAY-GIFYWLA 186 G ++ L+V T L+L+G+A++A + LA D A + W Sbjct: 130 SGLITTLIVYRLASSALGT-SVVLLLLSGVAVAALAGAGIGVLTYLANDMALRDLTLWQM 188 Query: 187 GGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLV 246 G ++ A+WQ V L V+ A LN L L ++ A LG+++ L+L + +L Sbjct: 189 GSIAGAQWQYVGLCLVVLALLSWQFNRDAKALNALLLGEAEARHLGIDVDSLKLRLILLC 248 Query: 247 LLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAF 306 L VG V+ G + FIGL+VPHL R G D + +LP+S LLGA L+ LAD+ ARA Sbjct: 249 ALGVGVSVAATGIIGFIGLVVPHLVRMLLGPDHQRLLPMSALLGAALLALADIGARAFLP 308 Query: 307 PGDLPAGAVLALIGSPCFVWLV 328 P +LP G V ALIG+P F++L+ Sbjct: 309 PAELPVGLVTALIGAPFFIFLL 330 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 338 Length adjustment: 28 Effective length of query: 304 Effective length of database: 310 Effective search space: 94240 Effective search space used: 94240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory