Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate 7026138 Shewana3_3280 ABC transporter related (RefSeq)
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__ANA3:7026138 Length = 326 Score = 165 bits (418), Expect = 1e-45 Identities = 85/251 (33%), Positives = 146/251 (58%), Gaps = 3/251 (1%) Query: 1 MTLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 M L+ L+ + +L+++S +LP G++ LIGPNG GKS+LL C R + P G + Sbjct: 19 MALKVSQLSWAIEGKTILSEISFALPQGEMLGLIGPNGAGKSSLLRCLYRFIRPAKGHIS 78 Query: 61 LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 L I+ LS + A +++++ Q +T ++LV+ G P ++ S+ D ++ Sbjct: 79 LFSQDISELSPKAFACKVAVVQQDTPQYFDMTTEQLVAMGLTPHKGMFDTNSSGDGEKIA 138 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 A+ + ++H ++ LSGG++QRA +A + Q +++LDEPT +LDI +Q+ ++ L Sbjct: 139 KALEKVGLSHKVHQQYDRLSGGEKQRALIARAIVQQPQLLILDEPTNHLDIRYQIQILEL 198 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAE 240 +R+ G +V+A +HDLN A CD L+++ G V A GTP +V+T + VF V A+ Sbjct: 199 ---VRSLGISVIASIHDLNLACALCDHLLLLDKGQVSAMGTPAQVLTEERIAEVFGVCAQ 255 Query: 241 IHPEPVSGRPM 251 + P P G P+ Sbjct: 256 VTPHPQHGNPL 266 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 326 Length adjustment: 26 Effective length of query: 229 Effective length of database: 300 Effective search space: 68700 Effective search space used: 68700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory