GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcB in Shewanella sp. ANA-3

Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (characterized)
to candidate 7026771 Shewana3_3903 ornithine carbamoyltransferase (RefSeq)

Query= SwissProt::Q9K4Y9
         (301 letters)



>lcl|FitnessBrowser__ANA3:7026771 Shewana3_3903 ornithine
           carbamoyltransferase (RefSeq)
          Length = 301

 Score =  404 bits (1039), Expect = e-117
 Identities = 190/299 (63%), Positives = 242/299 (80%)

Query: 1   MENLLSVKDLSKQQILDLLALAKAVKANPAEYSQALAGKSIVTIYEKPSLRTRVTFDIGI 60
           M++LLS+K+L++QQ+LDL+ LAK +KANPAEY  AL GKS+V ++EKPSLRTRV+FDIGI
Sbjct: 1   MKHLLSIKELTQQQLLDLITLAKTIKANPAEYRHALDGKSVVMLFEKPSLRTRVSFDIGI 60

Query: 61  HKLGGHAVYLDAQNGAIGERETVKDFAANISRWADAIVARVVSHKTLEGLVEHGSVPVVN 120
           +KLGGH +YLD QNGA+G+RE+V DFA+N+S WADAIVAR  SHKT+E L E G+VPV+N
Sbjct: 61  NKLGGHCLYLDQQNGALGKRESVADFASNLSCWADAIVARTFSHKTIEQLAEFGTVPVIN 120

Query: 121 SLCDLYHPCQALADFLTISEHYEDVSKVKLAYVGEGNNVTHSLMLTGAILGAEVTAVCPR 180
           +L DLYHPCQALADFLT++EH+E++S VKLAYVG+GNNVT+SLM   AILGA +T +CP 
Sbjct: 121 ALSDLYHPCQALADFLTLAEHFENISDVKLAYVGDGNNVTNSLMYCAAILGATMTVICPA 180

Query: 181 GSSPDAQIVKQAMALAEISGGKINVTDNLDDIVDYDVIYGDTWVSMGDDTPLAQVKEKYM 240
           G  PD  +V +   LA   GGK+ +T ++  I  +D IY DTW+SMGD TPLA++K+K+ 
Sbjct: 181 GHFPDGYVVAEVQELASRYGGKVVLTSDIGAIEGHDAIYTDTWISMGDPTPLAEIKDKFA 240

Query: 241 PYQINKALLMRTGIKHVLHCQPAHRELEITSEVMDGEHSLIFDQAENRMHAQNAVLLTL 299
           PYQ+NK L+ + G    +HC PAHR +E+T EVMDGE SLI  QAENRMHAQNAVL+TL
Sbjct: 241 PYQVNKGLMAKAGAHFFMHCLPAHRGVEVTDEVMDGEGSLILQQAENRMHAQNAVLITL 299


Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 281
Number of extensions: 2
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 301
Length adjustment: 27
Effective length of query: 274
Effective length of database: 274
Effective search space:    75076
Effective search space used:    75076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate 7026771 Shewana3_3903 (ornithine carbamoyltransferase (RefSeq))
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00658.hmm
# target sequence database:        /tmp/gapView.6869.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00658  [M=304]
Accession:   TIGR00658
Description: orni_carb_tr: ornithine carbamoyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   1.8e-108  348.3   0.0     2e-108  348.2   0.0    1.0  1  lcl|FitnessBrowser__ANA3:7026771  Shewana3_3903 ornithine carbamoy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7026771  Shewana3_3903 ornithine carbamoyltransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.2   0.0    2e-108    2e-108       1     303 [.       2     300 ..       2     301 .] 0.98

  Alignments for each domain:
  == domain 1  score: 348.2 bits;  conditional E-value: 2e-108
                         TIGR00658   1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnkeelq 77 
                                       +hlls+++l++++l +l+ lak++k++  +   ++ l gk++ ++Fek+s RtRvsf++++ +lG++ lyl++++  
  lcl|FitnessBrowser__ANA3:7026771   2 KHLLSIKELTQQQLLDLITLAKTIKANPAE--YRHALDGKSVVMLFEKPSLRTRVSFDIGINKLGGHCLYLDQQNGA 76 
                                       7*************************9998..5668***************************************** PP

                         TIGR00658  78 lgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgklkevklvyv 154
                                       lg++es++D a  ls + daiv+R+++h+++e+la++ +vPvin+L+dl hPcq+laD+lt+ e+++++++vkl+yv
  lcl|FitnessBrowser__ANA3:7026771  77 LGKRESVADFASNLSCWADAIVARTFSHKTIEQLAEFGTVPVINALSDLYHPCQALADFLTLAEHFENISDVKLAYV 153
                                       ***************************************************************************** PP

                         TIGR00658 155 GDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadviytDvwvsmGee 231
                                       GD+nnv+nsl+  aa lG +++v +P g  p+  +v + +++a+++ggk+ lt+d+  a+++ d iytD+w+smG+ 
  lcl|FitnessBrowser__ANA3:7026771 154 GDGNNVTNSLMYCAAILGATMTVICPAGHFPDGYVVAEVQELASRYGGKVVLTSDI-GAIEGHDAIYTDTWISMGDP 229
                                       *******************************************************8.69****************** PP

                         TIGR00658 232 ekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlkall 303
                                       +  +e  + + pyqvn+ l++ a     f+hCLPa+rG evtdev++ge s++ ++aenR+haq avl +l+
  lcl|FitnessBrowser__ANA3:7026771 230 TPLAEIKDKFAPYQVNKGLMAKAGA-HFFMHCLPAHRGVEVTDEVMDGEGSLILQQAENRMHAQNAVLITLF 300
                                       ***9****************99865.57****************************************9876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (301 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 10.11
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory