GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Shewanella sp. ANA-3

Align Phosphoglucomutase-2; PGM 2; Glucose phosphomutase 2; Phosphodeoxyribomutase; Phosphoglucomutase-1; Phosphopentomutase; EC 5.4.2.2; EC 5.4.2.7 (characterized)
to candidate 7025556 Shewana3_2707 phosphoglucomutase/phosphomannomutase alpha/beta/subunit (RefSeq)

Query= SwissProt::Q7TSV4
         (620 letters)



>lcl|FitnessBrowser__ANA3:7025556 Shewana3_2707
           phosphoglucomutase/phosphomannomutase alpha/beta/subunit
           (RefSeq)
          Length = 573

 Score =  336 bits (861), Expect = 2e-96
 Identities = 216/576 (37%), Positives = 299/576 (51%), Gaps = 45/576 (7%)

Query: 19  MDARLDQETAQWLRWDQNPLTSESVKQLIAGGNKEELRKCFGARMEFGTAGLRAPMGAGI 78
           M+  L  +   WL  D +P T   ++ LI  GN  EL   F  R+EFGTAGLR  +GAG 
Sbjct: 1   MNTHLQLQVKHWLENDPDPRTQAQLQALIDAGNDAELEARFAGRLEFGTAGLRGVVGAGP 60

Query: 79  SRMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPASGGSSRRFARLAATAFIT 138
             MN L I QT+ G   YL +Q  D  +RGVVI +D R        SR FA   A+    
Sbjct: 61  MGMNRLVIRQTSAGLGAYLLEQIKDAAERGVVIGYDGRH------DSRTFAHDTASVLTA 114

Query: 139 QGVPVYLFSDITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDR 198
            G+ V L + + PTP V + V H    AGI++TASHNP Q NGYKVYW+NGAQII PHD 
Sbjct: 115 MGIKVRLTAKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDS 174

Query: 199 GISQAIEENLEPWPQAWEESLVDSSPLLHNPSAS-------IGNDYFEDLKKYCFHRTVN 251
           GI+  I           E +   + P +    A+       + +DY+E  ++   H  V 
Sbjct: 175 GIAAKI-----------ELAATQAIPFMDQVEATKQGKLIWLQDDYYETYRRGVMHANVL 223

Query: 252 KES----KVKFVHTSVHGVGHEFVQLAFKAFDLAPPEAVPQQKDPDPEFPTVKYPNPEEG 307
           + +    KV   +T++HGVG E  +   K    A   +V  Q++PD +FPTV +PNPEE 
Sbjct: 224 QNNTAPEKVSLAYTAMHGVGAEMAETVLKDAGFAQVYSVVAQREPDGDFPTVNFPNPEE- 282

Query: 308 KGVLTLSFALADKIKAKIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSW 367
           KG + L  A A K  A +  ANDPDADR AVA ++D GE+++ +G+++G L G +L +  
Sbjct: 283 KGAMDLVIAEAKKHGAMLACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHA 342

Query: 368 KEKNQDQSNLKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAQQLGDQGKTV 427
            +    +  L  T ++SS++ SKI +      G     TLTGFKW+ N            
Sbjct: 343 SK----EQRLVGTTIVSSSLLSKIAKGF----GVESYTTLTGFKWLMNVGIAQSQPDNQF 394

Query: 428 LFAFEEAIGYMCCPFVLDKDGVSAAVICAELASFLATKNLSLSQQLNAIYVEYGYHITTA 487
           LFA+EEA+GY     V DKDG+SA V  A+L + LA K  ++  +L  IY E G+H+  A
Sbjct: 395 LFAYEEALGYTVGNMVWDKDGLSALVAFAQLTAELAAKGQTIWDRLEQIYREQGFHL-NA 453

Query: 488 SYFICHDQGTIQNLFGNLRNYDGKNNYPKMCGKFEISAIRDLTTGYDDSQPDKKAVLPTS 547
              I     T  N+   LR +      P   G+  + +  DL    +    D K      
Sbjct: 454 QVSIALKPDT-PNIGAYLREHP-----PLAIGEHALVSTDDL-KALERRFADGKVEKINL 506

Query: 548 KSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAP 583
            +S ++T+  ANG    +R SGTEPKIK Y E+  P
Sbjct: 507 PASDVLTYRLANGARVIVRPSGTEPKIKCYYEVVEP 542


Lambda     K      H
   0.317    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 874
Number of extensions: 43
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 620
Length of database: 573
Length adjustment: 37
Effective length of query: 583
Effective length of database: 536
Effective search space:   312488
Effective search space used:   312488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory