GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Shewanella sp. ANA-3

Align phosphate acetyltransferase (EC 2.3.1.8) (characterized)
to candidate 7024359 Shewana3_1551 phosphate acetyltransferase (RefSeq)

Query= BRENDA::Q8ZND6
         (714 letters)



>lcl|FitnessBrowser__ANA3:7024359 Shewana3_1551 phosphate
           acetyltransferase (RefSeq)
          Length = 717

 Score =  956 bits (2471), Expect = 0.0
 Identities = 480/715 (67%), Positives = 589/715 (82%), Gaps = 8/715 (1%)

Query: 1   MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGDAPDQTTTIVRAN 60
           MSR IMLIP GT VGLTS+SLG++RA+ER GV++  FKPI+Q R   + P+++TTI+  +
Sbjct: 1   MSRNIMLIPIGTGVGLTSLSLGMVRALERHGVKVQFFKPISQLRPNDNGPERSTTILSKS 60

Query: 61  STLPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVVLVEGLVPTRKHQFAQS 120
            T+   EP  M+H E+L+ ++Q DVLME+IIA       + E ++VEGLVPTR H FA  
Sbjct: 61  PTVNPLEPFDMAHAEALIRADQTDVLMEQIIARAAECASNTETLIVEGLVPTRNHPFADD 120

Query: 121 LNYEIAKTLNAEIVFVMSQGTDTPEQLNERIELTRSSFGGAKNTNITGVIINKLNAPVDE 180
           +NY IAK ++A+++F+ + G+DTP  L  R+E+  +S+GG  N  + G +INK+ APVD+
Sbjct: 121 VNYAIAKAMDADVIFIATPGSDTPTGLMNRLEIAYNSWGGKNNKRLIGAVINKIGAPVDD 180

Query: 181 QGRTRPDLSEIFDDS----SKAQVIKIDPAKLQESSPLPVLGAVPWSFDLIATRAIDMAR 236
           +GR RPDLSE+FD      S A ++   P K    SPL +LG+VP++ DL+A RA D+A+
Sbjct: 181 EGRARPDLSEVFDHQGVQRSDASIMFQMPGK----SPLRILGSVPYNLDLVAPRASDLAK 236

Query: 237 HLNATIINEGDIKTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVLVAACLAAMNG 296
           HL A I+N G++ TRR++ VTFCARS+P+M+ H +  SLLVTS DR DV+V+ACLAAMNG
Sbjct: 237 HLRARILNAGEMNTRRLRKVTFCARSLPNMVNHIKTDSLLVTSGDRSDVIVSACLAAMNG 296

Query: 297 VEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSFNLEVPVDDHER 356
           V+IGALLLTG YE +  I KLCE+AF TGLPVF+++TNTWQTSL++Q F+ EVPVDD  R
Sbjct: 297 VKIGALLLTGSYEPEPEILKLCEQAFETGLPVFLIDTNTWQTSLNIQRFDHEVPVDDAVR 356

Query: 357 IEKVQEYVANYVNAEWIESLTATSERSRRLSPPAFRYQLTELARKAGKRVVLPEGDEPRT 416
           I+ VQEYVA++++  WIES+T  S R  RLSPPAFRY+LTELAR A K VVLPEGDEPRT
Sbjct: 357 IDLVQEYVASHIDQSWIESVTKNSPREHRLSPPAFRYKLTELARAAHKTVVLPEGDEPRT 416

Query: 417 VKAAAICAERGIATCVLLGNPDEINRVAASQGVELGAGIEIVDPEVVRESYVARLVELRK 476
           +KAAAICAERGIA CVLLG  DEI R+AA Q V LG G+ IVDP+ VR+ YV  +++LR+
Sbjct: 417 IKAAAICAERGIARCVLLGKKDEIQRIAAQQDVVLGEGVVIVDPDEVRDRYVEPMLDLRR 476

Query: 477 SKGMTEPVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLV 536
           +KG+TE VA+EQLEDN+VLGT+ML Q+EVDG+VSGAV+TTANTIRPPLQLIKTAPGSSLV
Sbjct: 477 NKGLTEVVAKEQLEDNMVLGTMMLAQNEVDGIVSGAVNTTANTIRPPLQLIKTAPGSSLV 536

Query: 537 SSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSADSAIAFGIEPRVAMLSYSTGTSG 596
           SS+FFML+P+QV VYGDCAINPDP AEQLA+IAIQSA+SA AFGIEPRVAM+SYSTG SG
Sbjct: 537 SSIFFMLMPDQVLVYGDCAINPDPNAEQLADIAIQSAESAKAFGIEPRVAMISYSTGNSG 596

Query: 597 AGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAPNSPVAGRATVFIFPDL 656
            GSDV+KVREATR+A+EKRPDL+IDGPLQYDAAVM +VA+SKAPNSPVAG+ATVF+FPDL
Sbjct: 597 TGSDVDKVREATRIAKEKRPDLVIDGPLQYDAAVMPNVARSKAPNSPVAGQATVFVFPDL 656

Query: 657 NTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQASQ 711
           NTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQASQ
Sbjct: 657 NTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQASQ 711


Lambda     K      H
   0.316    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1388
Number of extensions: 46
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 714
Length of database: 717
Length adjustment: 39
Effective length of query: 675
Effective length of database: 678
Effective search space:   457650
Effective search space used:   457650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)

Align candidate 7024359 Shewana3_1551 (phosphate acetyltransferase (RefSeq))
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00651.hmm
# target sequence database:        /tmp/gapView.10265.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00651  [M=304]
Accession:   TIGR00651
Description: pta: phosphate acetyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   9.8e-138  444.7   0.2   1.4e-137  444.2   0.2    1.2  1  lcl|FitnessBrowser__ANA3:7024359  Shewana3_1551 phosphate acetyltr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024359  Shewana3_1551 phosphate acetyltransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  444.2   0.2  1.4e-137  1.4e-137       1     304 []     406     706 ..     406     706 .. 0.96

  Alignments for each domain:
  == domain 1  score: 444.2 bits;  conditional E-value: 1.4e-137
                         TIGR00651   1 ivlPEgseervlkAaallaekkiaekvllvnkeeevkn.kakevnlklgkvvvedpdvskdiekyverlyekrkhkG 76 
                                       +vlPEg+e+r++kAaa++ae++ia++vll++k+e+++  + ++v l  g vv++dpd    +++yve + ++r++kG
  lcl|FitnessBrowser__ANA3:7024359 406 VVLPEGDEPRTIKAAAICAERGIARCVLLGKKDEIQRIaAQQDVVLGEG-VVIVDPDEV--RDRYVEPMLDLRRNKG 479
                                       69*********************************99733444555444.555666655..6*************** PP

                         TIGR00651  77 vtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekeeevlvfaDCav 153
                                       +te  a+eql+D+++l++++++++e+dg+vsGav+tta+t+rp+lq+ikt++g++lvss+f+m  +++vlv++DCa+
  lcl|FitnessBrowser__ANA3:7024359 480 LTEVVAKEQLEDNMVLGTMMLAQNEVDGIVSGAVNTTANTIRPPLQLIKTAPGSSLVSSIFFMLMPDQVLVYGDCAI 556
                                       ***************************************************************************** PP

                         TIGR00651 154 avdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkekepdllldGelqfDaAlve 230
                                       ++dPnae+LA+iA+qsa+sak++g +ep+va++syst+ sg g++v+kv+eA++i+kek+pdl++dG+lq+DaA+++
  lcl|FitnessBrowser__ANA3:7024359 557 NPDPNAEQLADIAIQSAESAKAFG-IEPRVAMISYSTGNSGTGSDVDKVREATRIAKEKRPDLVIDGPLQYDAAVMP 632
                                       ************************.**************************************************** PP

                         TIGR00651 231 kvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnDLsRGasvedivnvviita 304
                                       +va++kap+s+vag+a+vfvFPdL++Gn++Yk+vqR+ad+ +iGP+lqG++kPvnDLsRGa+v+div+++++ta
  lcl|FitnessBrowser__ANA3:7024359 633 NVARSKAPNSPVAGQATVFVFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTA 706
                                       ************************************************************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (717 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 20.44
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory