Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate 7025539 Shewana3_2690 short chain dehydrogenase (RefSeq)
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__ANA3:7025539 Length = 255 Score = 118 bits (296), Expect = 1e-31 Identities = 89/265 (33%), Positives = 132/265 (49%), Gaps = 21/265 (7%) Query: 1 MSVLQRLQPYPGLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKY---- 56 M+VLQ G +I+G ++GIG A + GA++ + + LA D+ Sbjct: 1 MAVLQ------GKVAIITGASSGIGYATAKRFAREGAKLVLGARRGAILASLVDEIITQG 54 Query: 57 PGTVATRADVSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTG-GIDAISDAEWQATIN 115 + DV+D + + E GGLD+ NN GI G G DA+S AEW+ T+ Sbjct: 55 GEAIYLAGDVTDEVYASDLVALAVEQYGGLDIAFNNVGINGELGVDSDALSRAEWENTLT 114 Query: 116 INLTAQYRFAHHAVPMLKESSHGHLLHIASVAG-RLGYAWRTPYAATKWAIVGLMKSLAS 174 NLT+ + A + +P + + G ++ +S G +G+ YAA+K ++GL +SLA Sbjct: 115 TNLTSAFLAAKYQLPQMLKRGAGSIIFTSSFVGYTIGFPQTAAYAASKAGMIGLTQSLAV 174 Query: 175 ELGESDIRVNALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVA 234 E G IRVNALLPG + P E PEA + L+ +LKR+ ++A Sbjct: 175 EYGARGIRVNALLPGGTDTP-------MGREFANTPEAMAFVKNLH--ALKRLADPAEIA 225 Query: 235 AMALFLCSPAARNVTGQAISVDGNV 259 AL+L S AA TG A+ VDG V Sbjct: 226 QSALYLASDAASFTTGIALLVDGGV 250 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 255 Length adjustment: 24 Effective length of query: 238 Effective length of database: 231 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory