Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate 7026335 Shewana3_3477 ribokinase (RefSeq)
Query= reanno::Koxy:BWI76_RS00290 (309 letters) >FitnessBrowser__ANA3:7026335 Length = 303 Score = 279 bits (713), Expect = 7e-80 Identities = 148/298 (49%), Positives = 198/298 (66%), Gaps = 3/298 (1%) Query: 7 LVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGR---SGANISFIAC 63 ++V+GS NADH++N + P PG+T+ Y++ GGKGANQAVA R A ++FI Sbjct: 4 ILVIGSANADHVMNFEYLPVPGQTLMSRAYRLEHGGKGANQAVACARLCQGDAEVAFICH 63 Query: 64 TGDDDIGERVRRQLESDNIDVAPVRAVAGESTGVALIFVNAEGENTIGIHAGANAALCVA 123 G D +G +R D I + VA STG ALIFV GEN+IGI AGANA L + Sbjct: 64 LGQDSVGNDMRTSWLKDGIKAEGITQVANMSTGTALIFVGDNGENSIGIAAGANADLTPS 123 Query: 124 QVDAEKERIASAQALLMQLESPLESVLAAAKIAHQNQTSVILNPAPARELPDELLTLVDI 183 +++ A+AQ LL+QLE+P+E+V A + A + + +LNPAPA + L VDI Sbjct: 124 ELEKHYALFANAQFLLIQLETPMETVHHALQTAKRLGITTVLNPAPATSQELDYLKWVDI 183 Query: 184 ITPNETEAEKLTGVRVENDEDAAKAAKVLHDKGIGTVIITLGSRGVWASSEGNGRRVPGF 243 ITPNETEAE LTG+ V N+EDA AA+ LH +G+ TV+ITLGS+G + SS G +P Sbjct: 184 ITPNETEAEALTGIEVNNEEDAELAAQWLHQQGVATVVITLGSKGAFISSAGFTGLIPAL 243 Query: 244 KVQAVDTIAAGDTFNGALVTALLEGRELAEAIRFAHAAAAIAVTRKGAQPSVPWRKEI 301 VQA+DT+AAGDTFNGALV L EG +A A+ FA+AA+AI VTR+GAQ ++P+R E+ Sbjct: 244 TVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTREGAQRAIPYRHEV 301 Lambda K H 0.315 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 303 Length adjustment: 27 Effective length of query: 282 Effective length of database: 276 Effective search space: 77832 Effective search space used: 77832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
Align candidate 7026335 Shewana3_3477 (ribokinase (RefSeq))
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.28998.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-118 381.7 4.2 1.4e-118 381.6 4.2 1.0 1 lcl|FitnessBrowser__ANA3:7026335 Shewana3_3477 ribokinase (RefSeq Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7026335 Shewana3_3477 ribokinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.6 4.2 1.4e-118 1.4e-118 1 297 [. 4 302 .. 4 303 .] 0.99 Alignments for each domain: == domain 1 score: 381.6 bits; conditional E-value: 1.4e-118 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlg...aevsmigkvGkDefgeellenlkke 74 i+v+GS+n+D+v+++++lp+pG+t+ ++ +++ +GGKGANQAva+arl+ aev++i+++G+D++g++++ ++ k+ lcl|FitnessBrowser__ANA3:7026335 4 ILVIGSANADHVMNFEYLPVPGQTLMSRAYRLEHGGKGANQAVACARLCqgdAEVAFICHLGQDSVGNDMRTSWLKD 80 89**********************************************99999************************ PP TIGR02152 75 gidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlvllQlEipletveealkiak 151 gi++e +++v+++stG+Ali+v ++geNsI ++aGan++ltp++++++ + +++++++l+QlE+p+etv++al++ak lcl|FitnessBrowser__ANA3:7026335 81 GIKAEGITQVANMSTGTALIFVGDNGENSIGIAAGANADLTPSELEKHYALFANAQFLLIQLETPMETVHHALQTAK 157 ***************************************************************************** PP TIGR02152 152 kagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaekaaekllekgvkaviitlGskGallvs 228 + g++++lnPAPa++ ++ ++l++vdii+pNetEae+Ltgiev+++edae aa++l+++gv +v+itlGskGa+++s lcl|FitnessBrowser__ANA3:7026335 158 RLGITTVLNPAPATS-QELDYLKWVDIITPNETEAEALTGIEVNNEEDAELAAQWLHQQGVATVVITLGSKGAFISS 233 *************66.779********************************************************** PP TIGR02152 229 kdekklipalkvkavDttaAGDtFigalavaLaegksledavrfanaaaalsVtrkGaqssiPtkeeve 297 ++ + lipal+v+a+Dt+aAGDtF+gal+v L+eg+s+++av fanaa+a++Vtr+Gaq++iP+++ev+ lcl|FitnessBrowser__ANA3:7026335 234 AGFTGLIPALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTREGAQRAIPYRHEVQ 302 *******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory