Align Phosphotransferase system transporter enzyme I, FruI, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA (characterized)
to candidate 7025094 Shewana3_2257 phosphoenolpyruvate--protein phosphotransferase (RefSeq)
Query= TCDB::Q9HY55 (956 letters) >lcl|FitnessBrowser__ANA3:7025094 Shewana3_2257 phosphoenolpyruvate--protein phosphotransferase (RefSeq) Length = 567 Score = 323 bits (829), Expect = 1e-92 Identities = 206/561 (36%), Positives = 314/561 (55%), Gaps = 12/561 (2%) Query: 403 LQAIAASPGIASGPA-HV-QVAQRFEFQPRGESPAHERE-RLLRAKRAVDEEIVGLVERS 459 + I S GIA G A H+ Q +++P S +++ + ++A +A+ +++ + Sbjct: 3 ITGIIVSSGIAFGQALHLTQAEHHLDYRPIPLSRIPQQQSKFVKALQALQQQLSHSQTKL 62 Query: 460 TVKAIR-EIFVTHREMLDDPELAEQVQLRLNRGE-SAEAAWSRVVEDSAAQQEALHDALL 517 ++ ++ +L+D EL +QV+ + + SA A R+ A + E+L D L Sbjct: 63 DPQSENYQLIEADLLLLEDEELIDQVKEAIRTLQLSASVAVERIFAHQANELESLDDPYL 122 Query: 518 AERAADLRDLGRRVLARLCGV--EAPREPEQPYILVMDEVGPSDVARLDAQRVAGILTAR 575 A RA D+R LG+R++ + G + + +P IL+ ++ P++ A L ++++GI+ Sbjct: 123 ANRAQDVRCLGQRLVTAINGRLDQGLAQLTEPTILLAQDLTPAEFALLPKEQLSGIVLKT 182 Query: 576 GGATSHSAIIARALGIPALVGAGAAVLGLEPGTALLLDGEHGWLQVAPSTEQLQQAAAER 635 GG TSH+AI+ARA GIPA++ + GT L+LD G L V P+ E + Sbjct: 183 GGLTSHTAILARAAGIPAILSCQFDAEFIPNGTPLVLDALSGELFVNPAPELQARLTVTL 242 Query: 636 DARQQRQARADAQRLEPARTRDGHAVEVCANLGDTAGAARAVELGAEGVGLLRTEFVFMN 695 Q R+A A R PA+T+DGH V + AN+G+ ++GA+G+GL RTEF+ M+ Sbjct: 243 HHEQARRAALQAYRDVPAKTQDGHLVGLMANVGNLNDITHVGDVGADGIGLFRTEFMLMH 302 Query: 696 NARAPDLATQEAEYRRVLDALDGRPLVARTLDVGGDKPLPYWPIPHEENPYLGLRGIRLT 755 + PD Q Y L AL G+ RTLD+G DK LP E+NP LGLRG+R T Sbjct: 303 TSTLPDEKAQYNLYCEALHALGGKTFTIRTLDIGADKELPCLCQEVEDNPALGLRGVRYT 362 Query: 756 LQRPQILETQLRALFRAAGERPLRVMFPMVGSLDEWRQARDLALRLR-----EEIPLADL 810 L P++ +TQLRA+ RAA P+R+MFPMV ++E Q L + EE +L Sbjct: 363 LAHPELFKTQLRAILRAANHGPIRLMFPMVNQVEELDQIFALIAECQDALEEEEKGFGEL 422 Query: 811 QLGIMVEVPSAALLAPVLAREVDFFSVGTNDLTQYTLAIDRGHPSLSAQADGLHPAVLQL 870 GI+VE P+A + + +DF S+GTNDLTQY +A DR +P L+ L PA+L L Sbjct: 423 SYGIVVETPAAVMNLASMLPRLDFVSIGTNDLTQYAMAADRTNPQLTRDYPSLSPAILGL 482 Query: 871 IDMTVRAAHAEGKWVGVCGELAADPLALPLLVGLGVDELSVSARSIALVKAGVRELQLVA 930 I MTV A A G V +CGELA+ PL +PLL+G+G+DELSV+ ++ VKA V + QL Sbjct: 483 IKMTVDQAKAAGVKVSLCGELASSPLMVPLLIGMGLDELSVNLSALLEVKAAVCQGQLTK 542 Query: 931 ARGLARKALGLASAAEVRALV 951 LA A+ +E++ + Sbjct: 543 FSALAHTAMQQNRISELQQCI 563 Lambda K H 0.318 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 955 Number of extensions: 41 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 956 Length of database: 567 Length adjustment: 40 Effective length of query: 916 Effective length of database: 527 Effective search space: 482732 Effective search space used: 482732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory