GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HP1174 in Shewanella sp. ANA-3

Align Glucose/galactose porter (characterized)
to candidate 7025545 Shewana3_2696 major facilitator transporter (RefSeq)

Query= TCDB::P0C105
         (412 letters)



>lcl|FitnessBrowser__ANA3:7025545 Shewana3_2696 major facilitator
           transporter (RefSeq)
          Length = 452

 Score =  194 bits (493), Expect = 4e-54
 Identities = 138/435 (31%), Positives = 222/435 (51%), Gaps = 45/435 (10%)

Query: 15  TSSQKNYGFALTSLTLLFFMWGFITCLNDILIPHLKNVFQLNYTQSMLIQFCFFGAYFIV 74
           T+S +     +  + +LFF++GF+T LN  LIP LK   QLN  ++ L+ F F+ AYF++
Sbjct: 11  TASPQGSFIPMLLIGILFFVFGFVTWLNGALIPFLKIACQLNEFEAYLVTFVFYIAYFVM 70

Query: 75  SLPAGQLVKRISYKRGIVVGLIVAAIGCALFIPAASYRVYALFLGALFVLASGVTILQVA 134
           +LP   ++ R+ YK G+ +GL + A G  LFI AA    +A FL ALFVL +G+T+LQ A
Sbjct: 71  ALPTSSILTRLGYKMGMTLGLGIMAAGAGLFIVAALVGHFATFLLALFVLGTGLTLLQTA 130

Query: 135 ANPYVTILGKPETAASRLTLTQAFNSLGTTVAPVFGAVLILS---------------AAT 179
           ANPY+  +G  E+AA R++L    N     + P+     IL+               A  
Sbjct: 131 ANPYIVCIGPRESAAMRISLMGIVNKGAGFIVPIIFTAWILTGMEPYSETALASLSEAQR 190

Query: 180 DATVNAEADAVRFPYLLLALAFTVLA--IIFAILKPPDVQED-EPALSDKKEGSAWQYRH 236
              +   A+ +  PYL++ L    L   + F+ L  P++ E  E   +D K  +  QY  
Sbjct: 191 QLALTELANRLVHPYLMMMLVLLGLMAFVWFSPLPEPELGERVERTQTDWK--AILQYPQ 248

Query: 237 LVLGAIGIFVYVGAEVSVGSFLVNFLSDPTVAGLSETDAAHHVAYFWGGAMVGRFIGSAA 296
           ++LGA+ +F YVGAEV  G  +  F       GL         +Y  G  ++G  +G   
Sbjct: 249 VILGALTLFCYVGAEVIAGDSIGLFSQ-----GLGVAHFGMMTSYTMGFMVLGYVLGILL 303

Query: 297 M-RYIDDGKALAFNAFVAIIL-LFITVATTGHIAMWSVL-----------------AIGL 337
           + R+I    AL  +A   ++  L + ++ +   A+  +L                  +GL
Sbjct: 304 IPRWISQQTALVGSAIAGLLFTLGVLLSDSQSQALSELLLGWLGVLPVPDPVLYLALLGL 363

Query: 338 FNSIMFPTIFSLALHGLGSHTSQGSGILCLAIVGGAIVPLIQGALADAIG-IHLAFLMPI 396
            N++++P ++ LAL GLG  T+  S +L + I GGAI+PL+ G +A + G   +A+ + +
Sbjct: 364 ANALVWPAVWPLALEGLGRLTATASALLIMGIAGGAILPLLYGYIAHSQGDSQMAYFLLL 423

Query: 397 ICYAYIAFYGLIGSK 411
            CY  I +Y + G K
Sbjct: 424 PCYGLIFYYAIWGHK 438


Lambda     K      H
   0.328    0.141    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 554
Number of extensions: 41
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 412
Length of database: 452
Length adjustment: 32
Effective length of query: 380
Effective length of database: 420
Effective search space:   159600
Effective search space used:   159600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory