Align L-arabinonolactonase (characterized, see rationale)
to candidate 7024914 Shewana3_2088 hypothetical protein (RefSeq)
Query= uniprot:A0A1I2AUG6 (300 letters) >FitnessBrowser__ANA3:7024914 Length = 300 Score = 178 bits (452), Expect = 1e-49 Identities = 113/286 (39%), Positives = 152/286 (53%), Gaps = 9/286 (3%) Query: 11 NTLGEGILWCEREQALYWTDIQAATLWRHRPADGATRSWEMPERLGCLALCEADGWLLLG 70 N LGEG+LW + Q+++WTDI ++ ++R A + ++ MP R+G L L++ Sbjct: 17 NRLGEGVLWDDLHQSIWWTDILSSVIYRFHLASRSLETFPMPHRVGSFGLTAKPTTLIVA 76 Query: 71 LATRLAFFRPEDDLLLPLVSVEPDLP-TRLNDGACDRQGRFVFGTLHEPAAGETRQPIGA 129 +A + ED L L E R NDG DRQGRF GT+ E +T Q A Sbjct: 77 FDIGIAIYDIEDQSLTWLAQPESHFAGNRFNDGRIDRQGRFWAGTMVEQR--DTLQQTAA 134 Query: 130 FYRLNADLTLERLNLPGIGISNSVAFSPDGRTMYFCDSPSRVIQCCDYGDRCG---EPRV 186 Y L+ + +L + ISN + +S DGRT+Y DSP I D+ G R+ Sbjct: 135 LYCLDEKGHCHQ-HLTNLEISNGLCWSVDGRTLYHADSPKHQIYQYDFDIEQGLLSRKRL 193 Query: 187 FARVDDERGEPDGSAVDAQGCLWNAQWGLGRVVRYAPDGRVDRIVEVPATQPTRPAFGDS 246 FA PDGS VDA G LWNAQWG G+VVRY PDG VD I+++P T PT AFG Sbjct: 194 FASTSHHIF-PDGSDVDAAGYLWNAQWGGGQVVRYRPDGEVDLILKLPVTHPTSIAFGGE 252 Query: 247 PLDTLYITSARDGLSSAALATQPLAGALFAAD-AGASGLPEPRFRG 291 D L +TSA+ L ++ L +P AG +F G G+ PRF G Sbjct: 253 KRDLLIVTSAKHSLDASQLDQEPQAGDVFIYPLQGIYGVNSPRFCG 298 Lambda K H 0.321 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 300 Length adjustment: 27 Effective length of query: 273 Effective length of database: 273 Effective search space: 74529 Effective search space used: 74529 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory