GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglA in Shewanella sp. ANA-3

Align Galactose/methyl galactoside import ATP-binding protein MglA; EC 7.5.2.11 (characterized)
to candidate 7024900 Shewana3_2074 ABC transporter related (RefSeq)

Query= SwissProt::P23924
         (506 letters)



>lcl|FitnessBrowser__ANA3:7024900 Shewana3_2074 ABC transporter
           related (RefSeq)
          Length = 499

 Score =  345 bits (885), Expect = 2e-99
 Identities = 187/474 (39%), Positives = 300/474 (63%), Gaps = 11/474 (2%)

Query: 13  LLEMRGINKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSIVF 72
           +LE++ I+K +PGVKAL++V+L +    +HAL+GENGAGKSTL+K + G   KD G I+F
Sbjct: 4   ILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDILF 63

Query: 73  QGKEVDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGMFVDQDKMYQDTKA 132
            G+   F++  +A + GIS V+QE+NLV   +V  N++LG  P +   +   KMY D +A
Sbjct: 64  LGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYADARA 123

Query: 133 IFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTII 192
           +  +  +DID  A +   S++  Q+I IA+  + +AK++++DEPT+SL  KEV  LF I+
Sbjct: 124 VLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLFGIL 183

Query: 193 RKLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDKIIAMMVGRSLNQ 252
            +LK +G  IV+I+H +++++Q+ D IT+LR+GQ+I       L   K+I  M+GRSL +
Sbjct: 184 NQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRSLQE 243

Query: 253 RFPDKENKPGDVILEVRHLTSLR----QPSIRDVSFDLHKGEILGIAGLVGAKRTDIVET 308
           +  DK+ K   V      L SL     + SI+ ++  + KG+ +G+AGL+G+ R+++   
Sbjct: 244 QLVDKQEKERTVTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGRSEVCNA 303

Query: 309 LFGIREKSSGTITLHGKKINNHTANEAINHGFALVTEERRSTGIYAYLDIGFNSLISNIR 368
           +FG+    SG+I L G+K+N     +AI+ G AL  E+R+  GI   L I  N +++   
Sbjct: 304 VFGLDLVDSGSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENIILA--- 360

Query: 369 NYKNKVG---LLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLLTQP 425
             + ++G    L N+R +   Q+ ID +++ TP     I  LSGGNQQKVI+ RWL  +P
Sbjct: 361 -LQARIGWWRYLSNTRQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAIEP 419

Query: 426 EILMLDEPTRGIDVGAKFEIYQLIAELAKKGKGIIIISSEMPELLGITDRILVM 479
            +L+LDEPTRGID+GA  EI +LI  L  +G  +++ SSE+ EL+  +++++V+
Sbjct: 420 ILLVLDEPTRGIDIGAHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVVL 473



 Score = 73.2 bits (178), Expect = 2e-17
 Identities = 59/239 (24%), Positives = 113/239 (47%), Gaps = 11/239 (4%)

Query: 264 VILEVRHLTSLRQPSIR---DVSFDLHKGEILGIAGLVGAKRTDIVETLFGIREKSSGTI 320
           +ILE++ + S   P ++   DVS  L  GE+  + G  GA ++ +V+ + G + K  G I
Sbjct: 3   LILELKQI-SKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGDI 61

Query: 321 TLHGKKINNHTANEAINHGFALVTEERRSTGIYAYLDIGFNSLISNIRNYKNKVGLLDNS 380
              G+  + +T  +A   G + V +E     +   L +  N  +        ++GL+   
Sbjct: 62  LFLGEPQHFNTPMDAQKAGISTVYQE---VNLVPNLTVAQNLFLGY---EPRRLGLIHFK 115

Query: 381 RMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDVG 440
           +M +D + V+   ++        +   S   QQ + I R +    ++L+LDEPT  +D  
Sbjct: 116 KMYADARAVLTQFKLDIDVS-APLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAK 174

Query: 441 AKFEIYQLIAELAKKGKGIIIISSEMPELLGITDRILVMSNGLVSGIVDTKTTTQNEIL 499
               ++ ++ +L  KG  I+ I+  + ++  I+DRI V+ NG   G   T    Q +++
Sbjct: 175 EVQVLFGILNQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLI 233



 Score = 63.9 bits (154), Expect = 1e-14
 Identities = 47/217 (21%), Positives = 103/217 (47%), Gaps = 8/217 (3%)

Query: 28  ALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSIVFQGKEVDFHSAKEALE 87
           ++ ++NL V       L G  G+G+S +   +FG+   DSGSI   G++++     +A+ 
Sbjct: 273 SIQSMNLTVPKGQAVGLAGLLGSGRSEVCNAVFGLDLVDSGSIHLAGQKLNLSQPVDAIS 332

Query: 88  NGISMVHQELNL---VLQRSVMDNMWLGRYPTKGM--FVDQDKMYQDTKAIFDELDIDI- 141
            GI++  ++  +   +   S+ +N+ L      G   ++   +  +  +   D+L I   
Sbjct: 333 AGIALCPEDRKIDGIIGPLSIRENIILALQARIGWWRYLSNTRQQEIAQFFIDKLQIATP 392

Query: 142 DPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTIIRKLKERGCG 201
           D    +  LS    Q + +A+  +    ++++DEPT  +       +  +IR L + G  
Sbjct: 393 DADKPIEQLSGGNQQKVILARWLAIEPILLVLDEPTRGIDIGAHAEIVKLIRTLCDEGMS 452

Query: 202 IVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDM 238
           ++  S +++E+    +++ +LRD    A + L G ++
Sbjct: 453 LLVASSELDELVAFSNKVVVLRDR--YAVRELSGAEL 487


Lambda     K      H
   0.319    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 555
Number of extensions: 23
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 506
Length of database: 499
Length adjustment: 34
Effective length of query: 472
Effective length of database: 465
Effective search space:   219480
Effective search space used:   219480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory