Align ADP-specific glucokinase (EC 2.7.1.147) (characterized)
to candidate 7025639 Shewana3_2790 fructokinase (RefSeq)
Query= BRENDA::Q8R8N4 (312 letters) >FitnessBrowser__ANA3:7025639 Length = 306 Score = 127 bits (319), Expect = 3e-34 Identities = 82/273 (30%), Positives = 135/273 (49%), Gaps = 19/273 (6%) Query: 1 MRIGVDLGGTNIAVGLVEEDGKIIATGSRPTKPERGYEAIARDIAELSFELLQRMGISVK 60 +R+G+DLGGT I + + E+G + + R Y+ I +L E +G Sbjct: 2 IRMGIDLGGTKIELVALSEEGNELFR--KRINTPRDYQGTLNAIVDLVNEAEATLG---- 55 Query: 61 DVKSMGIGVPGVADNEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMENDANVAALAEAT 120 + ++G+G+PGV G+V A + + PL + + + + + NDAN A++EA Sbjct: 56 EKGTVGVGIPGVISPYSGLVKNANSTWINGHPLDVNLGELLGREVRVANDANCFAVSEAV 115 Query: 121 FGAGRGSKSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVI------GDNGIRCNC 174 GA G + +GTG G+G ++GK+++G + E GH + N RC C Sbjct: 116 DGAAAGKSVVFGVIIGTGCGAGVAINGKVHAGGNGIGGEWGHNPLPWMTKEEFNTTRCFC 175 Query: 175 GKIGCFETYASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALK 234 G C ET+ S T +R+ +A R N A G ++DA DE A+ Sbjct: 176 GNPDCIETFISGTGFVRDYNEALSRAVNVQ----AAPAKSGTEIMALVDAG---DEMAIA 228 Query: 235 IFEEYVKYLAVGIVNIINLFDPEVIILGGGVAN 267 F+ Y+ LA + ++IN+ DP+ I+LGGG++N Sbjct: 229 AFDRYMDRLARSLAHVINMLDPDAIVLGGGMSN 261 Lambda K H 0.318 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 306 Length adjustment: 27 Effective length of query: 285 Effective length of database: 279 Effective search space: 79515 Effective search space used: 79515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory