Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate 7025615 Shewana3_2766 3-hydroxyisobutyrate dehydrogenase (RefSeq)
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__ANA3:7025615 Length = 300 Score = 155 bits (392), Expect = 1e-42 Identities = 96/297 (32%), Positives = 158/297 (53%), Gaps = 10/297 (3%) Query: 5 VGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIIT 64 V FIGLG MG PM+ NLLKAG ++ V D P A+ + GA +STA A +V+IT Sbjct: 4 VAFIGLGNMGGPMAANLLKAGMTVRVFDLVPAAMQALADQGALVSSTACGAAAGANVVIT 63 Query: 65 MLPNSPHVKEVALG---ENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAP 121 MLP HV+ + LG E G++E T+LID S+I +++ ++ G+E +DAP Sbjct: 64 MLPAGKHVRNLYLGNGSEKGLLEVVAGDTLLIDCSTIDAQSAQLVAAEAAKSGIEFIDAP 123 Query: 122 VSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVAL 181 VSGG A GTL+ + GG F++ ++ AM ++ H G GAG V K+ N +++++ Sbjct: 124 VSGGTAGAAAGTLTFICGGSDIAFERAQPVLNAMGKNIFHAGGAGAGQVAKICNNMLLSV 183 Query: 182 NIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDA--KAPMVMD-----RNFKPGFR 234 + SEAL + G++P ++ ++ G+ L+ P VM+ + ++ GF Sbjct: 184 LMVGTSEALQMGIDHGLDPKVLSDIMKVSSGGNWTLEKYNPCPGVMENVPSSKGYQGGFM 243 Query: 235 IDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALACYYEKLAK 291 +DL +KDL + + + + P+ + + G+G D S++ + L K Sbjct: 244 VDLMVKDLGLSQEAALLSNSSTPMGSLARSLYVNHARQGNGRRDFSSIFEQFAPLKK 300 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 300 Length adjustment: 26 Effective length of query: 270 Effective length of database: 274 Effective search space: 73980 Effective search space used: 73980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory