Align Na+/H+ dicarboxylate symporter (characterized, see rationale)
to candidate 7026015 Shewana3_3163 sodium:dicarboxylate symporter (RefSeq)
Query= uniprot:L0GT47 (419 letters) >FitnessBrowser__ANA3:7026015 Length = 417 Score = 370 bits (951), Expect = e-107 Identities = 188/400 (47%), Positives = 267/400 (66%), Gaps = 3/400 (0%) Query: 11 LRLLVRLPLWQQILIGLALGVAAGMAFGADAQLLAPIGTLFLNAIKMLIVPLVFVSLVAG 70 L+ + R+P WQ++L G LG G+ G A +L P+G LF++AIKML+ PLVF ++V Sbjct: 3 LQTISRIPFWQKVLAGFILGALVGVLLGETATVLKPLGDLFISAIKMLVAPLVFCAIVVS 62 Query: 71 ITSMQDSAKLGRISLKTIAIYLVTTAFAVSIGLLFGALFSPGEGMNMVASGNEQAKQAPS 130 ITS+ L R+SLKT+ ++++T A IGL G+L G G +A+ + + P Sbjct: 63 ITSLGSQTNLKRLSLKTLGMFMLTGTVASLIGLAVGSLIDMG-GTMQLATTEVRERNIPG 121 Query: 131 LVSILVGLVPANPVTAFAEGNILQIIVFAIALGVSINLIGERGAPAVRLFDALAETFYKL 190 +L+ ++P NP + A+G +LQIIVFA +G++IN +GE+ P R +A AE ++L Sbjct: 122 FAQVLLDMIPVNPFASLADGKVLQIIVFAALVGIAINKVGEKAEPLKRTIEAGAEVMFQL 181 Query: 191 TDLVMRVAPIGVFALTAGVVGSHGAEVLLPLAGVIGVIYLASIAHVLLVYGGLLGLLARL 250 T +V+++ PIGVF L A VVG +G LLPL I IY+A++ H++ VYGGL+ A L Sbjct: 182 TRMVLKLTPIGVFGLMAWVVGEYGLSTLLPLGKFIAAIYIAALIHMIFVYGGLVKFAAGL 241 Query: 251 NPLRFFQGIAPALAVAFSTSSSSGTLPVSIECARKNLGVSEGVAGFVLPVGATINMDGT- 309 +P++FF+ PA VAFSTSSS GTLP S A + +GVS+ + FV+P+GAT+NMDG Sbjct: 242 SPVQFFRKAMPAQLVAFSTSSSFGTLPASTR-AVETMGVSKRYSAFVMPLGATMNMDGCG 300 Query: 310 AIYQGVLALFIAQAFGIDLSAGQYAMIILTATLASIGTAGIPGAGLIMLGLVLTAAGLPL 369 IY + A+FIAQ +GI L Y MI +TAT+AS+GTAG+PG+ ++ML + L GLPL Sbjct: 301 GIYPAIAAIFIAQIYGIPLDTLDYVMIAVTATVASVGTAGVPGSAMVMLTVTLGVIGLPL 360 Query: 370 EGVALIAGIDRILDMARTTVNVAGDLMTTTLVGRSEQELD 409 EG+A IA IDRI+DM RT NV GD+MT ++G+SE ELD Sbjct: 361 EGIAFIAAIDRIIDMIRTATNVTGDMMTAVVIGKSENELD 400 Lambda K H 0.324 0.140 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 417 Length adjustment: 32 Effective length of query: 387 Effective length of database: 385 Effective search space: 148995 Effective search space used: 148995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory