GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glpK in Shewanella sp. ANA-3

Align glycerol kinase; EC 2.7.1.30 (characterized)
to candidate 7026623 Shewana3_3756 glycerol kinase (RefSeq)

Query= CharProtDB::CH_121461
         (502 letters)



>lcl|FitnessBrowser__ANA3:7026623 Shewana3_3756 glycerol kinase
           (RefSeq)
          Length = 494

 Score =  749 bits (1934), Expect = 0.0
 Identities = 355/491 (72%), Positives = 423/491 (86%), Gaps = 1/491 (0%)

Query: 3   EKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLV 62
           +KKY+VALDQGTTSSRA+V DHDANI+SVSQREF Q+YP PGWVEHDPMEIWA+QSS L+
Sbjct: 2   QKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVLI 61

Query: 63  EVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLE 122
           E LA+A I SD++AAIGITNQRETTI+WEK+TGKP+YNAIVWQCRR++EICE LK  GLE
Sbjct: 62  ESLARAGIHSDEVAAIGITNQRETTIIWEKDTGKPVYNAIVWQCRRSSEICEQLKAQGLE 121

Query: 123 DYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVT 182
           DY+R NTGL++DPYFSGTK+KWILD+V  +R +A+RGELLFGTVDTWL+WK+T+G+VHVT
Sbjct: 122 DYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKRGELLFGTVDTWLLWKLTEGKVHVT 181

Query: 183 DYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISG 242
           D TNA+RT+LFNIH+L WD K+LE LDIP  MLPEV+ S  VYG T I G+ G+ IP++G
Sbjct: 182 DPTNAARTLLFNIHSLSWDTKLLEALDIPAAMLPEVKPSCSVYGTTRIAGE-GSEIPLAG 240

Query: 243 IAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNYA 302
           IAGDQQAALFGQLCV+ GMAKNTYGTGCF+LMNTG KAV+S +GLLTT+A G  GEVNYA
Sbjct: 241 IAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRSSHGLLTTVAVGAQGEVNYA 300

Query: 303 LEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYAR 362
           LEG+VFM GA+IQWLRDE+ LI DA D+EYFA+KV +TNGVY+VPAF GLGAPYWDP AR
Sbjct: 301 LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR 360

Query: 363 GAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQF 422
           GA+FGLTRG N NHIIRA LESIAYQ++D+L+AM  DSG RL +L+VDGGAVAN+FLMQF
Sbjct: 361 GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSGERLKSLKVDGGAVANDFLMQF 420

Query: 423 QSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNY 482
           Q+DI    V RP V E TALGAA+LAGLAVGFW ++ EL+ KA I++ F+P I+ ++R  
Sbjct: 421 QADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTELKYKACIDKHFKPNIDASQRER 480

Query: 483 RYAGWKKAVKR 493
            YAGW+ AV R
Sbjct: 481 LYAGWQDAVAR 491


Lambda     K      H
   0.318    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 808
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 502
Length of database: 494
Length adjustment: 34
Effective length of query: 468
Effective length of database: 460
Effective search space:   215280
Effective search space used:   215280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate 7026623 Shewana3_3756 (glycerol kinase (RefSeq))
to HMM TIGR01311 (glpK: glycerol kinase (EC 2.7.1.30))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01311.hmm
# target sequence database:        /tmp/gapView.7270.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01311  [M=496]
Accession:   TIGR01311
Description: glycerol_kin: glycerol kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
     1e-228  745.5   0.0   1.2e-228  745.4   0.0    1.0  1  lcl|FitnessBrowser__ANA3:7026623  Shewana3_3756 glycerol kinase (R


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7026623  Shewana3_3756 glycerol kinase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  745.4   0.0  1.2e-228  1.2e-228       1     494 [.       4     493 ..       4     494 .] 0.99

  Alignments for each domain:
  == domain 1  score: 745.4 bits;  conditional E-value: 1.2e-228
                         TIGR01311   1 kliaaiDqGttssraivfdkegeevakaqkelsqifpkegwvEhdpleilesvvkvlaealekleikaeeiaaiGit 77 
                                       k+++a+DqGttssraivfd+++++v+ +q+e++q +p++gwvEhdp+ei++s+ +vl e+l++++i+++e+aaiGit
  lcl|FitnessBrowser__ANA3:7026623   4 KYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVLIESLARAGIHSDEVAAIGIT 80 
                                       69*************************************************************************** PP

                         TIGR01311  78 nqREttvvWdketgkplvnaivWqdtrtakiveelkeetkeeelrektGLplstYfsatKlrWlldnveevrkaaee 154
                                       nqREtt++W+k+tgkp++naivWq++r ++i+e+lk+++ e+++re+tGL+l++Yfs+tK++W+ldnv+++r++a++
  lcl|FitnessBrowser__ANA3:7026623  81 NQRETTIIWEKDTGKPVYNAIVWQCRRSSEICEQLKAQGLEDYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKR 157
                                       ***************************************************************************** PP

                         TIGR01311 155 gellfGtvdtwliykLtggkvhvtdvtNASRtlllnletlkwdeellelfkipkellPeirsssevygeieekellk 231
                                       gellfGtvdtwl++kLt+gkvhvtd tNA+Rtll+n+++l+wd++lle+++ip+++lPe+++s +vyg+++ +   +
  lcl|FitnessBrowser__ANA3:7026623 158 GELLFGTVDTWLLWKLTEGKVHVTDPTNAARTLLFNIHSLSWDTKLLEALDIPAAMLPEVKPSCSVYGTTRIA-GEG 233
                                       *********************************************************************9998.89* PP

                         TIGR01311 232 eevpitgvlGdqqaalvgqlclkkgeaKntYgtGcFlllntGekkviskhglLttvayklggkkptkyalEGsvava 308
                                       +e+p++g++Gdqqaal+gqlc+++g+aKntYgtGcFll+ntG+k+v s+hglLttva   +g+   +yalEGsv+++
  lcl|FitnessBrowser__ANA3:7026623 234 SEIPLAGIAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRSSHGLLTTVAVGAQGEV--NYALEGSVFMG 308
                                       *********************************************************9999877..6********** PP

                         TIGR01311 309 GaavqwlrdnlklikkaeeveklaksvedsegvyfVPafsGLfaPyWdsdArgtivGltrkttkehiaraaleavaf 385
                                       Ga++qwlrd+l+li++a+++e +a++v d++gvy+VPaf GL+aPyWd++Arg+++Gltr+++++hi+raale++a+
  lcl|FitnessBrowser__ANA3:7026623 309 GATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAY 385
                                       ***************************************************************************** PP

                         TIGR01311 386 qardileamekdagvevkvLkvDGglsknnllmqiqadilgvkverpkvaettalGaAlaaglavgvwkseeeleks 462
                                       q++d+l+am kd+g ++k+LkvDGg+++n++lmq+qadi +v+v rp+v ettalGaA++aglavg+w+s +el+ +
  lcl|FitnessBrowser__ANA3:7026623 386 QSKDLLDAMIKDSGERLKSLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTELKYK 462
                                       ****************************************************************************9 PP

                         TIGR01311 463 aeaeektfepemdeeerekkykkwkeaversl 494
                                       a  + k+f+p++d+++re+ y+ w++av+r++
  lcl|FitnessBrowser__ANA3:7026623 463 ACID-KHFKPNIDASQRERLYAGWQDAVARTR 493
                                       9997.************************985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (496 nodes)
Target sequences:                          1  (494 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 7.93
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory