Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 7023448 Shewana3_0678 ABC transporter related (RefSeq)
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__ANA3:7023448 Length = 272 Score = 140 bits (354), Expect = 2e-38 Identities = 78/222 (35%), Positives = 131/222 (59%), Gaps = 3/222 (1%) Query: 50 DLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRR 109 D+SLSI G++ IMG SG GK+TL++ + P SG +L DG+D+ L E R+ Sbjct: 26 DISLSIPRGKVTAIMGPSGIGKTTLLKLIGGQLTPDSGQVLFDGQDVHAASRSQLFELRK 85 Query: 110 HKISMVFQSFGLLPHKSVLDNVAYGLKVR-GESKQVCAERALHWINTVGLKGYENKYPHQ 168 ++SM+FQS L +V DNVA+ L+ G +++ L + VGL+G P + Sbjct: 86 -RMSMLFQSGALFTDINVFDNVAFALREHSGLPEEIIRSIVLMKLEAVGLRGAAQMMPSE 144 Query: 169 LSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHD 228 LSGGM++R LARA+A + ++++ DE F+ DP+ + + EL L+ T + ++HD Sbjct: 145 LSGGMQRRAALARAIALEPEMVMYDEPFAGQDPISMGVLVKLIRELSDALNLTSIVVSHD 204 Query: 229 LDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFVQ 270 +DE + I + + ++ D ++I GTP E+ H+ + + +F+Q Sbjct: 205 VDEVLGIADYVYVVADKRVIAHGTPEELKHAD-NPQLKQFIQ 245 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 272 Length adjustment: 25 Effective length of query: 251 Effective length of database: 247 Effective search space: 61997 Effective search space used: 61997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory