Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate 7025397 Shewana3_2552 acyl-CoA dehydrogenase domain-containing protein (RefSeq)
Query= reanno::psRCH2:GFF2397 (379 letters) >FitnessBrowser__ANA3:7025397 Length = 596 Score = 119 bits (298), Expect = 2e-31 Identities = 98/318 (30%), Positives = 142/318 (44%), Gaps = 45/318 (14%) Query: 100 GNEQQKSDFLTPLARGEQIGAFALTEPQAGSDASSLRTRARRDGDHY-VLNGAKQFITSG 158 G+E K +L L GE G LTE AG+D + LRT+A D Y + G K FI+SG Sbjct: 141 GSEALKQKYLAKLVSGEWTGTMNLTESHAGTDLALLRTKAVPTADGYFAITGEKIFISSG 200 Query: 159 KHAGT-----VIVFAVTDPDAGKGGISAFIVPT----------DSPGYQVVRVEDKLGQH 203 H T +++ + D G GIS F VP ++ +E K+G H Sbjct: 201 DHQFTDNIVHLVLARLPDAPEGVKGISLFAVPKVLVNSDGSLGEANSLYASGLEHKMGIH 260 Query: 204 ASDTCQIAFEDLRVPVANRLGEEGEGYRIALANLEGGRIGIAAQAVGMARAAFEAARDYA 263 + TC + FE + +GE +G R + R+G+ Q +G++ A+++A YA Sbjct: 261 GNSTCVMVFEGA---LGELVGEPHQGLRAMFTMMNQARLGVGMQGLGVSEIAYQSALAYA 317 Query: 264 RDR------------ETFGKPIIEHQAVAFRLADMATQIAVARQMVHHAAA-LREVGR-- 308 +DR E PI+ H V L AR +V A L E R Sbjct: 318 KDRLQSRAISGAKAPEKAADPILVHGDVRRMLLSQKAFNEGARALVGQQALWLDEAERHS 377 Query: 309 ---PALVEASMAKLFA-------SEMAEKVCSAAIQTLGGYGYLADFPVERIYRDVRVCQ 358 A V A +A LF + C A Q GG+GY+ ++ +E+ RD R+ Sbjct: 378 DPAKAKVAAQLAALFTPVVKGFITNRGFNACVDAQQVFGGHGYIHEWGMEQFVRDSRIAL 437 Query: 359 IYEGTSDIQRL-VISRNL 375 IYEGT+ IQ L ++ R L Sbjct: 438 IYEGTNGIQALDLVGRKL 455 Lambda K H 0.320 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 596 Length adjustment: 33 Effective length of query: 346 Effective length of database: 563 Effective search space: 194798 Effective search space used: 194798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory