Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate 7025598 Shewana3_2749 ABC transporter related (RefSeq)
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__ANA3:7025598 Length = 346 Score = 101 bits (252), Expect = 2e-26 Identities = 65/209 (31%), Positives = 113/209 (54%), Gaps = 5/209 (2%) Query: 25 VDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKITFKGKNIAGLKSNQI 84 ++ ++ ++ + G + +GPNG GKST + + GLL+P +G I G+ + G + Sbjct: 41 INAVEDLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLSPTSGDIRVLGETLPGAEEKLR 100 Query: 85 VRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKIFAMFPR--LSDRRRQRAG 142 R+G Y+ Q +++ +LSV ENLE A I + + K ++ + L+ R +Q AG Sbjct: 101 RRIG--YMTQKFSLYDNLSVRENLEFVAQIYGLNRRQTKARLAELLSLYDLAGREKQMAG 158 Query: 143 TLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQINQEGTAIILVEQN 202 ++SGG++Q LA+ A + P LL LDEP++A+ P + +E++ + +GT ILV + Sbjct: 159 SMSGGQKQRLALAAATLHHPELLFLDEPTSAVDPENRREFWERLFDLCAQGTT-ILVSTH 217 Query: 203 ARKALEMADRGYVLESGRDAISGPGQELL 231 E +LE G G Q+L+ Sbjct: 218 YMDEAERCHGLAILERGIKRADGSPQQLM 246 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 346 Length adjustment: 26 Effective length of query: 221 Effective length of database: 320 Effective search space: 70720 Effective search space used: 70720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory