Align ABC transporter for Lactose, ATPase component (characterized)
to candidate 7026373 Shewana3_3515 ABC transporter related (RefSeq)
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__ANA3:7026373 Length = 349 Score = 190 bits (483), Expect = 4e-53 Identities = 101/239 (42%), Positives = 150/239 (62%), Gaps = 6/239 (2%) Query: 2 SELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDLT 61 S L L V Y G +V+KG+DL + GE + +GPSGCGK+TLLR +AGL+ IS G++ Sbjct: 3 STLNLHQVHSDYQGQQVLKGLDLTLAQGEILALLGPSGCGKTTLLRAVAGLQAISQGEIQ 62 Query: 62 IDDVRMND----VDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEA 117 I+ ++ V +RGI M+FQ YAL+PH+TV EN+ F + A + A+ + R+++ Sbjct: 63 INGKTVSGAGQFVPSEQRGIGMIFQDYALFPHLTVAENILFGV--AKLTPAQRKARLDDM 120 Query: 118 AHILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIA 177 +++L L R P +LSGGQ+QRV+I RA+ P++ L DEP SN+DA++R M EI Sbjct: 121 LALVKLEGLAKRYPHELSGGQQQRVSIARALAYEPQLLLLDEPFSNIDAQVRHSMMAEIR 180 Query: 178 RLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGS 236 + KQ + V+VTH + EA AD + + GV+ Q G +LY P + +VA F+GS Sbjct: 181 SILKQRNVSAVFVTHSKDEAFVFADTLAIFNQGVIVQHGRAENLYAAPNSRYVADFLGS 239 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 349 Length adjustment: 29 Effective length of query: 329 Effective length of database: 320 Effective search space: 105280 Effective search space used: 105280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory