Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate 7026138 Shewana3_3280 ABC transporter related (RefSeq)
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__ANA3:7026138 Length = 326 Score = 85.1 bits (209), Expect = 2e-21 Identities = 69/220 (31%), Positives = 106/220 (48%), Gaps = 11/220 (5%) Query: 21 LHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVFDDKDITDWQTAKIMRE 80 L E+S + QGE++ LIG NGAGK++LL L R G I +DI++ + K Sbjct: 36 LSEISFALPQGEMLGLIGPNGAGKSSLLRCLYRFIRPAKGHISLFSQDISE-LSPKAFAC 94 Query: 81 AVAIVPEGRRVFSRMTVEENLAMG-----GFFAERDQFQ-ERIKWVYELFPRLHERRIQR 134 VA+V + + MT E+ +AMG G F E+I E H+ Q+ Sbjct: 95 KVAVVQQDTPQYFDMTTEQLVAMGLTPHKGMFDTNSSGDGEKIAKALEKVGLSHKVH-QQ 153 Query: 135 AGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTIFLVE 194 +SGGE+Q I RA++ P+LL+LDEP+ L I+ +E +R G+++ Sbjct: 154 YDRLSGGEKQRALIARAIVQQPQLLILDEPTNHLD---IRYQIQILELVRSLGISVIASI 210 Query: 195 QNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAY 234 + N A L D +L+ G V T +L E + + Sbjct: 211 HDLNLACALCDHLLLLDKGQVSAMGTPAQVLTEERIAEVF 250 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 326 Length adjustment: 25 Effective length of query: 212 Effective length of database: 301 Effective search space: 63812 Effective search space used: 63812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory